KEGG   Aegilops tauschii (wheat D): 109755783Help
Entry
109755783         CDS       T04345                                 

Gene name
LOC109755783
Definition
(RefSeq) L-type lectin-domain containing receptor kinase IX.1-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ats  Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:ats00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ats01001]
    109755783 (LOC109755783)
Enzymes [BR:ats01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109755783 (LOC109755783)
Protein kinases [BR:ats01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109755783 (LOC109755783)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Stress-antifung Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: XP_020170262
Position
Unknown
AA seq 646 aa AA seqDB search
MAPCRLLLLAVAALLGAVSAAASDDYIPYVPASVCSTESNYTDGSKYEVQLDNLLHDLRD
GAIGNGGFFQTVEGTWPDKIYGQAMCYVDCDWSMCELCLKVAPIYLMTKGCPNNKRGAII
YDCCYQRYSDEQFFGHADLFEFGFVVQSESDGDDAVPMNQTKWELVTELMAEAAGSPRRF
ANGSRTYTDSRGNSQVMYGLVQCALGMLPSECANCLNTTLASMGGNTTTAKYRRYGCYIT
HGPDPIDVATPPPQSAGGPRGPNRRRLIVAVCAATGSVVFVLICISISVWMLFRRLERRT
HPPRLSNQDDEAMEDEFRQGTGPRRFRYSELAAATDNFSEAKKLGEGGFGPVYRGFLKGM
KIEVAIKRVSKGSKQGRKEYASEVRVISRLRHRNLVQIIGWCHAGCELLLVYELMPNGSL
DLHLYSADNVLWWPDRHRIVLGIGSALLYLHQDWEQCVLHRDIKTSNVMLDVSFNAKLRD
LGLARLVDHDRGLHTTELAGTLGYMDPECTVTGRASTESDVYSFGVVLLEIACGRRPTTA
RPDGTLIHLAQRVSELHGQGRILDAADPRLDGNFDLQEMERVLVVGLWCACHDQSLRPSI
RQAVNVLRLEAPLPERMPPVGQAAGPLLMPDFDSTGHSSSSTQQLI
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggccccttgccgcctcctgctcctagccgtggccgccttgctcggcgcagttagtgct
gctgcatccgatgactacataccgtatgttccggcttccgtttgttcaacggagagcaac
tacactgacggcagcaagtacgaggtccagctcgacaaccttctccacgacctccgcgac
ggggcaattgggaatggcggcttcttccagaccgtcgagggtacctggcccgacaagata
tacggccaggccatgtgctacgtcgactgcgactggtcaatgtgcgagctctgcctgaag
gtggcgccgatctacttgatgaccaaaggatgccccaacaacaaaaggggcgccatcata
tacgactgctgctaccaacgctactcagacgagcaattcttcggccacgccgacctcttc
gagtttgggttcgtcgtacaaagtgagagcgacggcgacgacgcggtccccatgaaccag
accaagtgggagctggtgaccgagctcatggcggaggccgccgggtcgccgcggcggttc
gccaacgggagccggacatacacggactcgagaggtaactcccaggtgatgtacggcctt
gtgcagtgcgccctaggcatgttgccgagcgagtgcgccaactgtcttaacaccacactg
gcgagcatgggcggaaacaccaccactgctaagtataggaggtacggctgctacatcacc
cacgggcccgatcccatcgacgtcgccacgcctcctccgcaatctgcaggaggtccgcgc
ggaccaaaccgacgacggctcatcgtggctgtgtgtgccgctacgggttccgtcgtcttt
gtgttgatctgcatcagcatctcggtatggatgcttttccgccgcctagagagaagaact
caccctcccaggttgtctaaccaagacgatgaggccatggaagacgagttcaggcaaggg
accggacccaggcgattccgctacagcgagctggcagctgccacggacaacttctcggag
gccaagaagctcggggaaggtgggtttggcccagtgtacaggggattcttgaagggcatg
aaaatcgaggtggctatcaagagagtgtccaagggctctaagcaggggaggaaggagtac
gcctccgaggtgagggtaataagccggcttcggcaccgcaacctcgtgcagatcattggc
tggtgccacgccggctgcgagctcctcctggtctatgagctcatgcccaacggcagcctc
gatcttcacctttacagtgcggacaatgtactatggtggccagacaggcataggatcgtg
ctggggatcggctctgcgcttctctacctgcatcaagactgggagcagtgcgtcctgcac
agggacatcaagacgagcaatgtgatgctggacgtatcgttcaatgccaagctccgcgac
ttggggctcgctaggctcgtcgaccacgacagagggttgcacacgacggagctcgccggc
acgctggggtacatggaccccgagtgcaccgtcaccggcagagccagcaccgagtcggat
gtctacagcttcggcgtcgtgttgcttgagatcgcgtgcggacggaggcctaccacggct
cgacccgacggcacgctcatccacctggcacagcgggtgtcagagctgcacgggcaaggg
aggatactcgacgcggccgacccacggctggatggcaacttcgatctccaagagatggag
cgcgtgctggtcgtcggcctctggtgcgcgtgccacgaccagagcctaaggccgtccata
aggcaggccgtcaacgtcttacggctggaggcgccgctccccgagaggatgccgccggtt
ggccaagcggccggccctcttctcatgccggacttcgatagtacgggtcacagctccagc
tccactcagcagctaatatga

DBGET integrated database retrieval system