KEGG   Aegilops tauschii (wheat D): 109757377Help
Entry
109757377         CDS       T04345                                 

Gene name
LOC109757377
Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ats  Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:ats00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ats04131]
    109757377 (LOC109757377)
Membrane trafficking [BR:ats04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    109757377 (LOC109757377)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-ProteinID: XP_020171789
Position
Unknown
AA seq 1835 aa AA seqDB search
MESPAAGEGQRFKRIPRQPCGRNLELDPLLNENLEQWPHLNELVQCYNADFVKDGCKYGR
YESVAPPSFQNQIFEGPDTDIETELQLCNARHSKPEETTEDDMPSTSGRQIYETEPSASS
SKKHCTLSPLPAYEPAFDWDNERSLIFGQRLPESLPATHSSGLKITVKVLSLSFQTGLVE
PFSGTICLYNRDRREKLSEDFYFHILPTEMQDAHISLDRRGVFSLDTPSPSICLLIQLEK
AATEEGGVTPSIYSRKEPVHLTEKEKQKLQVWSRVMPYREPFAWAMIPLFENNHAGGDAA
SPSSPLAPSMSGSSSQDSIVEPISKLASDGKLNHYSSGSSVIVEISNLNKVKESYMEDSL
QDPKRKVHKPVKGVLRLEVEKLHNDRNEADTISEGGSITNELHDAGELNNGRHSRNSIDG
IHSSLNSSAIVKKDTHQNGQSSNGENGNNFQAFDFRMMARSEPFSQLFHCLYVYPLTVSL
SRKRNLFVRVELRKDDSDIRKLPVEAVHPRDQNSTLQKCAHTQISVGTRMSCYHDEVKIS
LPALLTPQHHLLFTFLHVDLQMKLEAPKPVIVGYAALPLSTHIQLLSDVSLPILRELVPH
YLQESGKEKMDYLEDGKTVFRLRLRLCSSLFPVNERIRDFFVEYDRHTLHTSPPWGSELL
EAINSLKNVESIALLQFLQPILNMLLHLIGDGGETLQVAAFRAMVNILTRVQQESSDGAE
RNKFLVNYVDFAFDDFGDRQTPVYPGLSTVWGSLARSKAKGYRVGPVYDDVLAMAWFFLE
LIVKSMGLEQSRLFYHNLPLGEDVPPLQLKEGVFRCIMQLFDCLLTEVHERCKKGLNLAK
RLNSTLAFFCYDLLSIIEPRQVFELVSLYMDKFAGVCQSVLHDCKLTFLQIICDHDLFVE
MPGRDPTDRNYLSSVLIQEIFLTLDHDDLSQRAKAARILVVLICKHEFDARYQKSEDKLY
IAQLYFPLIGQILDEMPVFYNLNAIEKREVLVVILQIIRNLDDTTLIKAWQQSIARTRLF
FKLLEECITHFEHNRTGDSLLLGSSSRSPDAERPASPKYSDRLSPSVNAYLSEASRHEIR
PQGTPENGYMWNRISPQLSSPNQPYSLREALAQAQSSRIGSTARALRESLHPILRQKLEL
WEENLSTAVSLEVLGIIDKFSVAAASRSISTDYAKLDCVTSILMGLLSRSQPLTFWKAFL
PVVYNIFSLHGATLMARENDRFLKQIAFHLLRLAVFRNDSVRKRAVVGLQILVRNSFNYF
KSTTRLRVMLTITLSELLSDVQVTQMKSDGSLEESGEARRLRKSLEEMADVRSKDQLNDC
GLPVTALEVAAEGSTDNRWSWVEVKHLSKCLVQALDAGLEHALLGSVMSVDRCAAAEGFY
KLALAYAPVPDLHIMWLLHLCDAHQEMQSWAEAAQCAVAVAGVIMQALVGRNDAVWSKEH
VASLCRICPIVGTDIGAEVAAAEVEGYGASKLTVDSAVKYLQLANKLFAQAELYHFSASI
QELIIPVYKSRRSYGQLAKCHTSLTSIYESILEQEASPIPFIDATYYRVGFYGERFGKLN
KREYVFREPRDVRLGDIMEKLSHTYEAKMDVNHTLHIIPDSRQVNADELQPGVCYLQITA
VDPVMEDEDLESRRERIFSLSTGSVRARVFDRFLFDTPFTKNGKTQGGLEDQWKRRTVLQ
TEGSFPALVNRLVVIKSESLEFSPVENAIGMIETRTAALRNELEEPRSSEGDQLPRLQSL
QRILQGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCKRAIRVHFR
LIGEEDQEFHTQLVNGFQSLTAELSHYIPAILSEL
NT seq 5508 nt NT seq  +upstreamnt  +downstreamnt
atggaatctccggcggccggggaaggacagcggttcaagcgtattccaaggcagccttgt
ggccggaacctggagctggatccactgcttaatgagaatttggaacagtggccacatcta
aatgagctagtacagtgttataacgctgattttgtgaaagatggctgcaaatatggacgc
tatgagagtgtcgcgccaccgtcctttcagaatcaaatttttgagggacctgataccgac
atagaaacagaattgcagctttgcaacgctaggcattccaagcctgaggaaactactgag
gatgatatgccaagcacttcagggaggcaaatatatgaaactgaaccatctgcttcatct
tcaaaaaaacattgtactctctcacctttaccggcatatgaacctgcatttgattgggac
aatgagagatctttaatatttggccaacgcttgccagaaagtctccctgcaacacacagc
agtggattgaagataacggtcaaggtattgtctttgtcattccaaactggattagtcgag
ccttttagcggtacaatctgcttgtacaacagagataggagagaaaagctatcggaggac
ttctacttccacatacttccaacagaaatgcaagatgctcatatatctttggatcgtcgg
ggtgttttctcattggacaccccttcaccatcaatctgccttctgatccagctagaaaag
gctgctactgaagaagggggagtaactccttccatttattcccgtaaagaacctgtgcac
ttgactgagaaagagaagcagaagctgcaagtttggtctcgagtcatgccatacagagag
ccatttgcatgggcaatgattcctctgtttgaaaacaaccatgctggtggtgatgctgcc
tctcctagcagccctttagcaccaagtatgtcaggctcaagttctcaagatagcattgtg
gagcctatctccaaactcgcttcagatggaaaactcaaccattattcaagtggaagttct
gttattgttgagatatcaaacttaaacaaagtgaaggaaagctacatggaagactccctc
caagatccaaaacgaaaagtacacaagccagtgaaaggtgtgctaaggctagaggtggaa
aaacttcataatgaccgtaatgaggcggataccatttctgaaggtgggagcataaccaat
gaattgcatgatgctggcgagctcaataatggcagacatagcaggaatagcattgatggg
atccacagttctctgaactctagtgccattgtcaagaaagatacacaccagaatggtcaa
agttccaatggagagaatggcaacaattttcaagcttttgactttcggatgatggcccgg
agtgaaccattttcacaacttttccattgtctctatgtgtacccattgactgttagcttg
agccgcaaaagaaatctatttgtaagggtagaattaaggaaggatgattctgacatacgt
aaacttccagtagaggctgtccatccaagggatcagaattcaacactacagaagtgtgcc
catacccaaatttctgttggcacaagaatgtcttgctaccatgacgaagttaagatcagt
ctgcctgctctattgacgccccaacatcatcttctgttcacatttttgcatgtagatctc
caaatgaaacttgaagcccctaaaccagtgattgtgggatatgctgcacttccactgtcg
acacacattcagttactttcggatgtgtctttgccaattttacgagagcttgttccgcat
tacctgcaggaaagtggaaaggaaaaaatggactacctggaggatggaaaaactgtgttc
aggctgcggttaagactttgctcttcgttgtttccagttaatgaaaggataagggacttt
ttcgttgagtatgaccgtcacacactacatacaagtccaccttggggttctgagcttctt
gaggcaataaatagtttaaagaatgttgaatctattgcattgttacaatttcttcaacca
atactcaatatgctgctacatcttattggcgatggtggtgaaacccttcaggttgctgca
tttcgagccatggttaatattctaacccgggtgcaacaggaatcatctgatggagctgag
agaaataagtttctcgttaattatgttgattttgcttttgacgacttcggtgatcggcag
acgcctgtataccctggtttgtctactgtttggggcagcctagctcgaagtaaggctaaa
ggttatagagttggacctgtctatgatgatgtgttggcaatggcttggttttttctggag
cttattgtaaaatcaatgggattggaacaaagtcgtctcttctaccacaatcttccactt
ggtgaagatgtcccaccgctgcagttgaaggaaggagtcttcagatgcatcatgcagcta
tttgattgccttctaactgaggttcatgaacgctgtaaaaagggtttaaacttggcgaag
cgcttgaacagcactcttgctttcttctgttacgatcttttatcaatcattgagccacgc
caagtttttgagctggtttcactgtatatggacaagtttgcaggggtttgccagtcagtc
ctccatgattgcaaattgacattcctgcaaataatatgtgatcatgatctttttgttgag
atgcctggtcgggatcccactgataggaattatctctcgtcggttcttattcaagagatc
tttctcacccttgaccatgatgatttgtcacagcgagcgaaagcggctcgtattttagtt
gttcttatatgcaagcatgaatttgacgcgcgatatcaaaaaagtgaagacaagctgtac
attgctcagctgtattttcctcttataggacagattctggatgagatgcctgtgttctat
aacctaaatgccattgaaaaacgtgaagtgctagtggtcattttgcaaatcataaggaac
ttggacgacacaactcttataaaagcatggcaacagagcattgctagaaccagattgttc
ttcaagctacttgaagaatgtataacccattttgagcataacagaacaggagacagcttg
ctactaggttctagttctcggagccctgatgctgagcgccctgcgtcccccaagtattct
gatcggttatccccatcagttaacgcatatttgtctgaggcttcgcgccatgaaataagg
ccccagggaacaccagaaaatgggtacatgtggaacaggattagtcctcagctaagttcc
ccaaatcaaccctattcattgagggaagcacttgcgcaagcgcaatcttcaagaatagga
tcaacagccagggcattgagagagtccctacatccaatactgagacaaaagttggaactc
tgggaagaaaatcttagtactgctgtgagccttgaagtcttgggaataattgataagttt
tcagttgctgcagcttctcgaagcatctcgactgactatgctaagctagattgtgtaaca
tctatcttgatgggtcttttatctaggagccagcccttgactttttggaaagctttcctt
cctgtagtctataatatatttagtctccatggtgcaacactgatggcaagggagaatgac
cgcttcttgaagcaaattgcttttcatcttttgcgacttgctgtattccgaaatgattct
gttagaaaaagggccgttgttgggttgcagatccttgtcaggaactcattcaactatttc
aagagcaccacaaggctgagggtcatgttgactattactttgtcagaactgctatctgat
gtgcaagtaactcagatgaaatccgatggatctcttgaagaaagtggtgaagctcggcgt
cttaggaaatcactggaggaaatggctgatgtaaggagtaaggatcagttgaatgattgt
ggccttcctgttactgcactggaagtggctgctgaaggttccacagacaataggtggtct
tgggtagaggttaagcatctatcaaagtgtctagtccaggcccttgatgctggccttgaa
cacgcccttttgggttctgtaatgagtgtggacaggtgtgcagctgctgagggtttctat
aagctagcattggcctatgcccctgttccggatcttcacattatgtggttactgcacctt
tgtgatgcacaccaggagatgcagtcatgggctgaggctgcgcagtgtgcagttgctgta
gctggtgtgatcatgcaggcacttgttggaaggaacgatgctgtctggagcaaggagcat
gttgcctccctctgtaggatttgccctattgtgggcactgatataggtgcagaagtagct
gcagcagaagttgaaggatatggtgcatccaagcttactgtggattcggccgtcaagtat
cttcaacttgcgaacaaactcttcgcacaagctgaactttaccacttctctgccagtatc
caggaacttatcattcctgtgtacaaaagcagaaggtcttatgggcagctggctaaatgt
cacacgtcactcacaagcatatatgagtcaattcttgaacaggaggctagccctatcccg
ttcattgatgctacctactacagagttggattctatggggaacgatttggcaagctcaat
aaaagggagtatgtgtttagggagccgcgggatgttcgtctgggtgacattatggagaag
cttagtcatacctatgaggctaagatggatgtgaatcacacgttacatatcattcctgac
tcgaggcaagtcaatgctgatgagctgcaacctggtgtatgctatctacaaataactgcc
gttgatcctgtaatggaggacgaggacttggagagcaggagggaaaggattttctcttta
tccactggttctgttcgtgcacgtgtgtttgaccgtttccttttcgacacaccattcaca
aagaacggaaaaacgcaaggcggcctagaagatcaatggaagagacgcacagtgctccag
acagagggttcctttcctgctctggtaaatcgtctggtggtgataaaatctgaatctcta
gagttttcacctgtggagaatgcgattggaatgattgaaacaaggacagctgcattgaga
aatgaactagaagaaccacggagctctgaaggcgatcaactaccaagacttcaaagcctg
caaaggatactccaaggaagtgtggctgttcaggtaaacagtggtgtattaagtgtttgc
accgctttcttatctggcgagcctgcaaccaggctccggtctcaagaactgcaacagctg
atagctgcattgcttgaattcatggctgtctgcaagcgtgcaatccgtgtgcattttaga
ttgataggggaagaagaccaggaattccacacgcaacttgtcaatgggtttcagtctctt
actgctgagctttctcactatattcctgccatactttcggagctatga

DBGET integrated database retrieval system