KEGG   Aegilops tauschii (wheat D): 109761720Help
Entry
109761720         CDS       T04345                                 

Gene name
LOC109761720
Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 3-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00052  Galactose metabolism
ats00500  Starch and sucrose metabolism
ats01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ats00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    109761720 (LOC109761720)
   00500 Starch and sucrose metabolism
    109761720 (LOC109761720)
Enzymes [BR:ats01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109761720 (LOC109761720)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: XP_020176139
Position
Unknown
AA seq 584 aa AA seqDB search
MGMAAAPLIVSLLYCTVLAVHASHVVYPELQSLEATEVDKELRTGYHFQPPKHWINDPNG
PMYYKGLYHLFYQYNPKGAVWGNIIWAHSVSTDLIDWVALEPGIYPSKPFDINGCWSGSA
TILPNGVPVIMYTGIDPKERQVQNVAYPANLSDPFLRKWVKPDYNPIINPDHGINASAFR
DPTTAWYGPDGHWRLVVGSKENMRGIAVLYRSRDFRRWIKAHHSLHAGLTGMWECPDFYP
VAVAGGRRHHQSGVDTAELHDSTVAAEVKYVLKVSLDVTRYEYYTIGWYDHAKDRYTPDL
DFPDNDYGLRYDYGDFYASKSFFDPVKKRRVLWGWANESDTVPDDRNKGWAGIQAIPRKI
FLSRSGRQLIQWPVEEIKSLRAKHVNVSNKAVKGGDYFKVGGFKSVQSDVEAAFMIKNLE
KAEKFNASWRTDAQGLCKKLNSHVKGGVGPFGLWLLASDDLKERTAVFFRVFKNNDTSYV
VLMCNDPTRSSFESQIYRPTFAGFVNIDITKTKKIALRTLIDHSVVESFGAGGKTCILTR
VYPRKAVGDNAHLFVFNNGESDIKLTNLRAWEMKTPTMNKRLGQ
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggggatggcggcggcgccattgatcgtgtctctgttgtactgcacggtgttggcggtg
cacgcgtcgcatgtcgtatacccggagctccagtcgttggaggccacggaggtggacaag
gagctgcgcacggggtaccacttccagccccccaagcattggatcaatgatccaaatggg
ccgatgtactacaaggggctgtaccatctcttctaccagtacaaccccaagggcgccgtg
tgggggaacatcatctgggcgcactcggtgtcgaccgacctcatcgactgggtggcgttg
gagcccgggatctacccgtccaagccgttcgacatcaacggttgctggtcgggctctgcc
accattctgcccaacggcgtcccggtcatcatgtacacaggcatcgaccccaaggaacgc
caggtgcagaacgtcgcgtacccggccaacctctccgaccccttcctccgcaagtgggtc
aagcccgactataaccccatcatcaaccccgaccatggcatcaacgccagcgccttccgt
gatcccaccaccgcttggtacgggccagacggacactggaggctggtggtgggcagcaag
gagaacatgagggggatcgcggtgttgtacaggagccgtgactttaggaggtggatcaag
gcacaccactcgctgcacgctgggctcacggggatgtgggagtgcccagacttctacccc
gtggcggtggccggcggcagacgtcaccaccagagcggtgtggacaccgcagagctgcat
gacagcacagtcgctgcggaggtaaaatatgtgctcaaggtgagcctcgacgtaacgcgc
tacgagtactacaccattggctggtacgaccatgccaaggacaggtacacccctgacctc
gacttcccagacaatgactacggtctccgatacgactatggcgacttctatgcatccaag
tcattctttgacccggtcaagaagcgtcgcgtgctctggggctgggccaatgaatcagac
actgtccccgacgaccgcaacaagggttgggccggcatccaggcgataccgaggaagatc
ttcctgtcacggagcggtaggcagctaattcagtggccggtagaggagatcaagtcattg
cgtgcgaagcacgtcaatgtcagcaacaaggccgtcaagggcggcgactacttcaaggtc
ggcggcttcaaatccgtgcagtcggacgtggaggcggcgttcatgatcaagaaccttgag
aaggcggagaaattcaacgcgtcgtggcggacagacgcgcaggggctgtgcaagaagctc
aactcacatgtcaagggcggcgtcgggccatttgggctctggttgctcgcctccgacgac
ctcaaggaaagaacagctgttttcttcagggtattcaagaacaatgacaccagctatgtc
gtcctcatgtgcaacgaccctacaaggtcgtcattcgagtcgcagatctacaggccgacc
ttcgccggcttcgtcaacatcgacataaccaagaccaagaagatcgccctcaggacattg
atcgaccactctgtggtggaaagttttggtgccggcggcaagacgtgcatcctgacgagg
gtctacccgaggaaggccgtcggggacaacgcacacctattcgtcttcaacaatggcgag
tcggacatcaagctcaccaacctgcgtgcatgggagatgaagacccccacgatgaacaaa
cgtctggggcagtag

DBGET integrated database retrieval system