KEGG   Aegilops tauschii (wheat D): 109764430Help
Entry
109764430         CDS       T04345                                 

Gene name
LOC109764430
Definition
(RefSeq) sphingosine kinase 1-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00600  Sphingolipid metabolism
ats01100  Metabolic pathways
Module
ats_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    109764430 (LOC109764430)
Enzymes [BR:ats01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     109764430 (LOC109764430)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-ProteinID: XP_020178837
Position
Unknown
AA seq 515 aa AA seqDB search
MADPQAEARGPPEPRAETLVELVRVNGSAAEATLSSAELAWRTTGAGRDSGGRRKLELES
DVLGFQVEGRSLKLATFTRGDVTGAGRPPSPVGCGGGAEDRKRGEVAVEMESEEAAERWG
HAIRDRFASLGRPKRLFFIVNPYGGKRGGRKIFQTEVLPLIDAAHIHYTMQETNYRLHAQ
EIAGSLDLKKYDGIVCVSGDGILVEVVNGLLQRDDWDKAIKVPLGIIPAGTGNGMVQGLL
HSAGEPFSMSNAVFAIIRGHRRALDVTSVVQGKTRFFSVMMLTWGLVADIDIESEKFRWM
GSARIDFYSLLRAVNLRRYNGRILFVPAPGYEGFGDPVEQTISCKSNGATNAAEGDIPDV
CNNETCTYSGPSTDDADLEWRSLKGPFVNVWISNIAFASEGVMIAPQAQFADGYLDAAII
KDCPWSVALGLLLRMKDGSYIESPYVEYFKVKALRIEPGLRVGSSTIGGIIDSDGEVLAR
GDRSQTKEEPEHLMAYGPPIQLMVDQGLATIFSPR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggccgacccgcaggccgaagcgcgaggcccaccggagccccgggcggagaccctggtg
gagctcgtgcgggtcaacggctctgcggcggaggccacgctctccagcgccgagctggcg
tggcgcaccaccggcgccggccgcgacagcgggggaaggcggaagctggagctggagtcc
gacgtgctcgggttccaggtggagggcaggtccctcaaactcgcgacctttacgcggggg
gacgtgacgggcgcggggaggccgccgtctccggtgggctgcggcggaggagcagaggac
aggaagagaggggaggtggcggtggagatggagagcgaggaggccgcggagaggtggggg
cacgccatcagagatcgcttcgcctcgcttggtcgaccgaagagactgttcttcatagtg
aacccttacggtgggaagagaggtgggcggaagattttccaaaccgaagttctgcctctt
attgatgctgctcacatccattacaccatgcaagaaacaaattaccgtcttcatgctcaa
gaaattgctggttcactggatcttaagaaatatgatgggatcgtttgtgttagtggagat
ggtatccttgtagaggttgttaatggtctgctgcaaagagatgattgggacaaagcaata
aaagtgccactagggatcattccagcaggtactggaaacggaatggtgcaaggtctattg
cattctgctggtgaacccttctcgatgtcaaatgctgtgtttgcaatcatcagaggtcac
agacgtgcccttgatgtcacttctgttgttcagggaaagacaaggtttttcagtgtcatg
atgcttacatggggtttggtagctgatattgatattgagtcagaaaagtttaggtggatg
ggaagcgctcgcatcgacttctattcccttctacgtgcggtgaacttgcgacggtacaat
gggcgtattctttttgttcctgccccaggatatgaaggatttggtgatcctgtggagcaa
accatcagctgtaaatcaaatggggctaccaatgctgccgaaggagacataccagatgtt
tgtaataatgaaacatgtacctattcaggtccttcaactgacgatgctgatcttgaatgg
agatcactgaagggtccgtttgttaacgtttggatcagcaacattgcttttgctagtgaa
ggtgtcatgatagcaccacaagcacagtttgcagatggctacttggacgcagctataatc
aaggattgcccatggtcggttgcgctcgggctcttgcttcggatgaaggatggtagctac
attgaatcgccctatgtggagtacttcaaggtgaaggctctccggatcgagccgggcctg
cgcgtcggcagcagcaccataggcggcatcatcgactccgacggagaggtcctcgcgaga
ggcgacaggtcccaaaccaaggaagagccggagcatctaatggcgtatggcccccctatc
caactgatggtggatcaggggctggccaccatcttctccccaagatga

DBGET integrated database retrieval system