KEGG   Aegilops tauschii (wheat D): 109765793Help
Entry
109765793         CDS       T04345                                 

Gene name
LOC109765793
Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00480  Glutathione metabolism
ats00590  Arachidonic acid metabolism
ats01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109765793 (LOC109765793)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109765793 (LOC109765793)
Enzymes [BR:ats01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     109765793 (LOC109765793)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin AHJR-like
Motif
Other DBs
NCBI-ProteinID: XP_020180152
Position
Unknown
AA seq 171 aa AA seqDB search
MGAAESSSKLGGSVHDFVVKDVRGNDVELSRYKGKVLLIVNVASRCGLANSNYTELGQLY
EKYREKGFEILAFPCNQFAGQEPDSDEKIVEFACNRFQAEFPIFRKVDVNGNNAAPLYKF
LKSERGGLFGERIKWNFTKFLVDKEGHVMNRYAPTWSPLGIENDIKKLLEV
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcggcagagtcatcctccaagcttggtggttccgtccatgacttcgtcgttaag
gatgtgagaggaaatgatgtggagctcagcagatacaaggggaaagtcctgcttattgtg
aatgtcgcatctcggtgtggtctggcaaattccaactacacggagctgggccaactctat
gagaaatacagggagaaagggtttgagatactggcattcccctgcaatcaatttgccgga
caggaaccagatagcgatgaaaagattgtggagtttgcttgtaaccgcttccaagcagag
tttcctatttttcgcaaggttgacgtgaacggcaacaatgctgccccactgtacaagttc
ttgaagtcagagagaggcggtctattcggagagcgtatcaaatggaatttcaccaagttc
ctagttgacaaagaggggcacgtcatgaaccgatatgcaccgacctggtccccactcggc
attgagaatgacatcaagaagctgttggaggtttga

DBGET integrated database retrieval system