KEGG   Aegilops tauschii (wheat D): 109767955Help
Entry
109767955         CDS       T04345                                 

Gene name
LOC109767955
Definition
(RefSeq) putative receptor-like protein kinase At4g00960
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ats  Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:ats00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ats01001]
    109767955 (LOC109767955)
Enzymes [BR:ats01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109767955 (LOC109767955)
Protein kinases [BR:ats01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109767955 (LOC109767955)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Motile_Sperm Kinase-like Seadorna_VP7
Motif
Other DBs
NCBI-ProteinID: XP_020182315
Position
Unknown
AA seq 454 aa AA seqDB search
MDFELHLIKSITNNFSKNQEVGSGAYGAVYRAVHNGEEIAVKRLHALQGLDDKEFDNEFR
NFTKIFHKNVVRLIGYCYESQEKFVEHNGDLIRAKAMERVLCFEYMQRGSLEKYIGDKPC
ELDWTTCYEIIKGTCEGLNHLHMQKKHIFHLDMKPANILLDNSMAPKIADLGLSKLVSST
ITYKAEVKKGTYGYMPPEYINNGFISEKFDVFSLGVIIIKMMAGNTGHVSCFEMSPKEFI
ELVSKTWKEKMQAVSGYSSHEIYILQVRRCIEIALRCICKDRKERPNIEKIVHELEELEV
ETNKIALPFDRSKDLILKRSCATNDVAVDPAFELRFLFEPRKEVSCCLQLTNKTDGFLAF
NIKVNKNKYRAQPSIGTMPPCSKCYVIVTLRPQGAAPPNMQCHDMLLVQSISISEQLASE
DTQISYQEVFKTTLAEKVVDEVKLPIVYVPLLDG
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggactttgagctccatttgattaagagtattacaaacaatttttcgaagaaccaagaa
gttgggagcggtgcatatggagctgtttacagggcggtgcataacggggaagagattgct
gtgaagaggcttcatgccttgcaaggacttgatgataaggaattcgataatgaattccgt
aattttacaaagatctttcacaaaaacgttgtaaggttaattggttactgctatgaatca
caagaaaaattcgttgagcacaatggggacctaattcgtgctaaagctatggagcgagtt
ctttgcttcgaatatatgcagcgtggaagccttgagaaatatattggagataaaccttgt
gaacttgattggacaacatgttatgaaattattaaagggacatgtgagggtttaaatcat
cttcacatgcagaaaaaacatattttccatctggacatgaaacctgctaacatattgcta
gataatagcatggctcccaaaattgcagatcttggtttatccaagcttgtttcttccaca
ataacatataaagcagaggtgaaaaaaggaacatatgggtacatgccaccagagtacata
aacaatggattcatatctgagaagtttgatgtgttcagtctgggggtcataattataaaa
atgatggctgggaatacaggccatgtcagctgttttgaaatgtccccaaaagagttcatt
gagcttgtaagtaaaacttggaaggagaagatgcaggcagtgtcagggtattcatctcac
gagatatacatccttcaagtgcgcagatgcattgagatagcattgcgatgtatatgcaag
gatcgaaaagaaagacctaatatagagaaaattgttcatgaactggaggaactggaggtt
gagaccaataaaattgcactaccttttgatcggtcaaaagacctaattctgaagagaagt
tgtgccaccaatgatgtggcggtggacccagcgttcgagttgcgcttcctcttcgagccg
aggaaggaggtgtcgtgctgcctgcagctcaccaacaagacggatggtttcctcgcgttc
aacataaaggtcaacaagaacaagtaccgcgcacagcccagcattggcacaatgcctccg
tgctccaagtgttatgtcatcgtgacgctgcgtccgcagggggcggcaccacccaacatg
cagtgtcacgacatgctgctcgtgcagagcatcagcatcagcgagcaactggcatcagaa
gatactcaaatttcttatcaagaagtgttcaagacaaccttagcggagaaggtggtagat
gaggtgaaactgccaattgtttatgttcctttattggatggataa

DBGET integrated database retrieval system