KEGG   Aegilops tauschii (wheat D): 109769287Help
Entry
109769287         CDS       T04345                                 

Gene name
LOC109769287
Definition
(RefSeq) fructose-bisphosphate aldolase, chloroplastic
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00010  Glycolysis / Gluconeogenesis
ats00030  Pentose phosphate pathway
ats00051  Fructose and mannose metabolism
ats00710  Carbon fixation in photosynthetic organisms
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
ats01200  Carbon metabolism
ats01230  Biosynthesis of amino acids
Module
ats_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ats_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
ats_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109769287 (LOC109769287)
   00030 Pentose phosphate pathway
    109769287 (LOC109769287)
   00051 Fructose and mannose metabolism
    109769287 (LOC109769287)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109769287 (LOC109769287)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ats04131]
    109769287 (LOC109769287)
   03036 Chromosome and associated proteins [BR:ats03036]
    109769287 (LOC109769287)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ats04147]
    109769287 (LOC109769287)
Enzymes [BR:ats01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     109769287 (LOC109769287)
Membrane trafficking [BR:ats04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109769287 (LOC109769287)
Chromosome and associated proteins [BR:ats03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    109769287 (LOC109769287)
Exosome [BR:ats04147]
 Exosomal proteins
  Proteins found in most exosomes
   109769287 (LOC109769287)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-ProteinID: XP_020183628
Position
Unknown
AA seq 388 aa AA seqDB search
MASATLLKSSFLPKKAEWGATRQAAAPKPMTVSMVVRASAYADELVKTAKTIASPGRGIL
AMDESNATCGKRLASIGLENTEANRQAYRTLLVTPPGLGNYISGAILFEETLYQSTVDGK
KIVDILVEQGIVPGIKVDKGLVPLVGSNDESWCQGLDGLASREAAYYQQGARFAKWRTVV
SIPNGPSELAVKEAAWGLARYAAISQDNGLVPIVEPEIMLDGEHGIERTFEVAQKVWAET
FYYMAQNNVMFEGILLKPSMVTPGAECKDRATPEEVASYTLKLLQRRIPPSVPGIMFLSG
GQSEVEATLNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGRPENVAAAQEALLLRAKAN
SLAQLGKYTSDGEAAEASENMFVKNYSY
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgctactctcctcaagtcgtctttccttcccaagaaggccgaatggggcgcc
acgcgccaggctgccgcccccaagccgatgaccgtctccatggttgtccgtgccagcgcg
tacgccgatgagcttgtcaaaaccgcgaaaaccatcgcatcgccaggcaggggtatcctt
gccatggatgagtcgaatgccacctgtggcaagagactcgcctcgattggccttgagaac
actgaggctaaccgccaggcttaccggaccctccttgtcactccaccaggattgggaaac
tacatctctggtgctatcctctttgaggagaccctctaccagtcgactgttgatggcaag
aagattgttgacatccttgtcgagcagggaatcgttcccggtatcaaggttgacaagggt
cttgtgccacttgttggttccaacgatgagtcatggtgccaaggtctcgatggccttgcc
tcccgtgaagcagcatactaccagcaaggcgcccgcttcgccaagtggcgcactgttgtc
agcattcctaatggcccatctgagcttgctgtcaaggaagctgcctggggtcttgcccgt
tacgcggccatctcacaggacaatgggctggtgccgattgtggagcctgagatcatgctc
gacggtgagcacggcatcgagaggaccttcgaggtcgcgcagaaggtgtgggcggagacc
ttctactacatggcccagaacaacgtcatgtttgagggcatcctcctgaagccaagcatg
gtgacccctggtgccgagtgcaaggacagggccacccccgaggaagtggccagctacacc
ctcaagctcctccagagaaggatccccccttccgtccccggcatcatgttcttgtctggc
ggtcagtcggaggtggaggcgacgctgaacctgaacgcgatgaaccaggcgccgaacccg
tggcacgtgtccttctcctacgcgcgggcgctccagaacacctgcctcaagacgtggggt
gggcggccggagaacgtggccgcggcgcaggaggcgctgctgctgcgcgccaaggccaac
tccctggcgcagctcggcaagtacaccagcgacggcgaggccgcggaagccagcgagaac
atgttcgtcaagaactacagctactga

DBGET integrated database retrieval system