KEGG   Aegilops tauschii (wheat D): 109769794Help
Entry
109769794         CDS       T04345                                 

Definition
(RefSeq) uncharacterized protein LOC109769794
  KO
K01513  ectonucleotide pyrophosphatase/phosphodiesterase family member 1/3 [EC:3.1.4.1 3.6.1.9]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00230  Purine metabolism
ats00240  Pyrimidine metabolism
ats00500  Starch and sucrose metabolism
ats00740  Riboflavin metabolism
ats00760  Nicotinate and nicotinamide metabolism
ats00770  Pantothenate and CoA biosynthesis
ats01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109769794
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109769794
   00240 Pyrimidine metabolism
    109769794
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    109769794
   00760 Nicotinate and nicotinamide metabolism
    109769794
   00770 Pantothenate and CoA biosynthesis
    109769794
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ats04090]
    109769794
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ats00537]
    109769794
Enzymes [BR:ats01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     109769794
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.9  nucleotide diphosphatase
     109769794
CD molecules [BR:ats04090]
 Proteins
  109769794
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ats00537]
 Enzymes
  109769794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphodiest A_thal_3526 Sulfatase Pex14_N
Motif
Other DBs
NCBI-ProteinID: XP_020184093
Position
Unknown
AA seq 860 aa AA seqDB search
MKDSQDIQSTTELQMSPQGTNEVQSNQLNTMATDAPAGDPGSLTVASNDNRKVSREDIEL
VQNLIERCLQLYMTKGEVVRTLSTRARIEPGFTTLVWQKLEEENPEFFRAYYIRLKLKRQ
IILFNHLLQHQCNLMKYPAHPNVPLAPMQNGMHPMPVNNLPMGYPVLQQPLMPAPGQPHI
DPMVCGLSGGHVVNGIPAPGGYQPIRMNSGNDMVVDNGAPEVAHGAMSSEMAVSPSSAAS
SNHAPFTPSEIPGMAMDTSMLDSAFGSDIGNTEPLQLGPDGSSRDSIRSLGQLWNFSLSD
LTADLTSLGDLEALENYEGTPFLPSDSDLLLDSPDHNDDIVEYFADAINGSQSDEENTMA
TTESDRHDSAPPTTNPQSHSELELPPMAAPPVSDHPHSPGDSPLPTDALLAHPQPPSAPA
PQPPTASRFLIILTAALAVSTSYLLLLRPPFSAVSASTASFARPLSKLPKPVVLLISSDG
FRFGYHHKAPTPHIRRVIANGTSAAEGLIPVFPTLTFPNHYSIVTGLHPSSHGIVNNFFP
DPISGDSFNMSSHEPKWWLGEPLWVTAADQGVRASTFFWPGSEVKKGSWDCPDKYCRHYN
GSVPFEDRVDAILGYFDLPVDEMPQFLTLYFEDPDHQGHQVGPDDPAITDAVTHIDEMIG
RLIAGLEARGVFEDVNIILVGDHGMVGTCDQKLVFLEELAPWIEVKADWVLSRTPLLAIR
PPDGVSPAVVVAKMNEGLSSGKVKNGQYLKMYLKEDLPSRLHYSESYRIPPIIGLVAEGY
KVEMKVSKKNECGGAHGYDNAFFSMRTIFIAHGPRFEEGKIVPSFVNVEIYNVIASILSL
KPAPNNGSSSFPGTVLLPSE
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgaaggattctcaggatattcagagcacaacagagctgcagatgtcaccccaaggtacc
aatgaagtgcaaagtaaccaactaaacacaatggccactgatgctcctgcaggagatcct
ggttctttgacagtcgctagtaatgataatagaaaagtctcccgtgaagacattgaactt
gtccagaatttgatagagcgctgtctgcagctatacatgaccaaaggagaggttgttagg
acgctttctactcgcgcgagaatagaacctggcttcactactttagtatggcagaaactc
gaagaagagaaccctgaattctttcgggcttactatataagattgaaactgaaaagacag
attatcttgttcaaccatttgttgcagcatcagtgtaatttgatgaaatatccagcacat
ccgaatgttccactggctccaatgcaaaatgggatgcatcctatgccagttaacaatcta
ccaatggggtatccagtacttcagcaacctctgatgcctgctcctggccagcctcacatt
gatccgatggtttgtggtctatccggcggtcatgtggtgaatgggatccctgcaccaggt
ggctatcaaccaattcgcatgaactccggaaatgacatggttgttgacaacggtgcacct
gaagttgcacatggtgccatgtcatccgagatggctgtgagtccctcatcggcagcatca
agcaaccatgctcctttcactccgtcggagataccagggatggccatggatacatcgatg
ctagattcagcatttggatctgacatagggaacacagaacctctgcaattagggccagat
gggtcgtcaagggattccatccgatccttggggcagctttggaatttcagcctctctgat
cttacagctgatttgacaagtttaggagatttggaggctcttgagaactacgaaggtacc
cctttcctgccctcggactcggacctcttacttgattccccagaccataatgatgacata
gttgagtacttcgccgacgccatcaacgggagtcaatcagacgaagagaacaccatggcg
actacagaatcagatcgacacgattccgccccacctaccacaaacccccagagccacagc
gaactcgagctccccccaatggcagctccgcccgtctccgaccacccccattcccccggc
gactcgccgctccccaccgacgccctcctggcgcacccccaacccccctccgcccccgcg
ccccagccccccaccgcctcccgcttcctcatcatcctcaccgccgccctcgccgtctcc
acctcctacctcctcctcctccgcccgcccttctccgccgtgtccgcctccaccgcatcc
ttcgcacggccgctatccaagctcccgaagccggtggtcctcctcatatcctccgacggc
ttccgcttcggctaccaccacaaggcccccaccccgcacatccgccgcgtcatcgccaat
ggcacctccgccgccgagggcctcatccccgtcttccccaccctcaccttccccaaccat
tactccatcgtcaccggcctccacccttcctcccacggcatcgtaaacaacttcttcccc
gaccccatctcgggggacagcttcaacatgagctcccacgagcccaagtggtggctcggg
gagcccctctgggtcaccgccgccgaccagggggtccgggcctccacgttcttctggccg
ggctcggaggtgaagaagggatcctgggactgtccagacaagtattgccgccactataat
ggctctgtgccatttgaggacagggttgacgccatccttggttactttgatctcccggtt
gatgaaatgccgcagttcctgacactgtactttgaggatccagatcaccaggggcaccag
gttggtcctgatgacccagccatcaccgatgctgtgacgcacattgacgagatgatcggg
aggctcattgctggtttggaagctaggggggtgttcgaggatgtgaacattattttggtt
ggggatcatgggatggttgggacctgcgaccagaagctagtgtttctcgaggaattggct
ccatggattgaggtgaaggctgattgggttctttcgaggacaccattgctggcaatcagg
ccaccagatggtgtatccccggcagtggtcgtggccaagatgaatgaagggctgagctct
gggaaggtgaagaatgggcaatatctgaagatgtacttgaaggaggatttgccttctcgc
ctgcattactcggaaagctataggataccaccaattattgggctggtagctgaaggttat
aaggtggagatgaaagtatcaaagaaaaatgagtgtggaggggcgcacgggtatgacaat
gccttcttctcaatgaggaccatattcatcgcacacgggcctcgtttcgaagagggtaaa
attgtgccctcgtttgttaatgtggagatatacaatgtcattgcttccattctcagtttg
aagccagctccaaacaatggctccagttctttccctggaacagttcttttaccgagtgaa
tga

DBGET integrated database retrieval system