KEGG   Aegilops tauschii (wheat D): 109770442Help
Entry
109770442         CDS       T04345                                 

Gene name
LOC109770442
Definition
(RefSeq) Fanconi anemia group D2 protein
Organism
ats  Aegilops tauschii (wheat D)
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 FANCI_S2 FemAB
Motif
Other DBs
NCBI-ProteinID: XP_020184733
Position
Unknown
AA seq 1491 aa AA seqDB search
MVFLQRSNPRKRPPPAPTAPGPPPPPSATPSAPTPAEPSVVDAAAALLADAGCTLLVPPH
LPPSLPSAPTFVPRLTRALAADPAADLPARLLAGLAAFAESPTRLRQLLLPTSPRSLSLA
RVLLSVPALQPGLLGLLLDKLPEHFDDDALDGVPLQDDVGRLIVAQFRWLDFLVDADTFV
TKLVEVLSVAPPRLKKEIIGSIPEIVGDQSHAAVVSALEKLLQEDSQVVVAVLDTLSNLN
LDALLQEQAVTVAISCIRTIHADQMPHLLRFLLLSATPANVGRIISQIREQLKFVGVVDP
RAARSKKLKGKASATSTDGAILDALRSGLRFKNMLCEAFLKELKLVDHARDHKVIDVWLI
MLIYANGGALQKSAEKILKSKILQGYIRETLFHQCIHGNTEIVKDNFMSYLSVSDYLLAC
KEDKAREFATYLFTALFEEFSDTFSRQELVGSLITHIGSGVSYEVSSALDIMISLTSNNS
EELIPIASHITGILDYLESFHEDNLRKVYEIFCQLALAAGFNTSSGGSSVANELLMVVRK
QVSNPDMKYKRMGIIGALRIVSAIADANAAVNYSSSQQPNCEEALGLLNMTVNSCKFVTL
PLILLYDELSALFESNVLHSAIIEWVGEHVAEFDTLFLADLEDGQLSEKYLCESIEGELW
MNLDGNISPVCVNILPLVSTSQQRSQACLQILPSQFLLLTTIERSGSEGSLGGINALLGC
PLHLPSTKNLDESRWGSLSALEKKTVCHSLYFAINWIRELLNAFSTQVAARVDNVSQRVR
DETAVKLLKRLRNLILLEILLNTLLKIYPLSLPELRYLGNYSGSTSSSKFNTGKKIEEDN
MEGPSSNKRQKGRKDKAASDKLNSDEKLKQSTILDAFKRAGVTITQETKKASSRPLPSGM
TSKDVESEANNPGELGHIDLMAAPVQLDMQRFKFRTLHVNCLSLLKYSEFQDSTYPYHES
ELPLYLYLLRDLNNKLDHVNPSSKPFFNNSQAKSTRAHCQKSTEDLLSKIQPLFSSLRKH
LDGSVSMMKDRSDSSPDNWSSHSDSAGNPHIPYVMVSKSSIATSVFKEVLGCYRKLLGTP
DLLNQANMSALKELLQTFQPTENFDDDLSEFRPPLVPSNVDYLYCGAFKMFEAIMDAVCL
FSHILASDVLITMQSILNSIIVLLEKSGESNGKNMHGGCSKEIIPFVKKQLGLSAHKLLT
SDFPNEDTENGWQSKGDLIARILQIYLRNSESTSVLLDELACLVLPQVASLKSKSTTQEL
SHGFPTLCSSTFHSWCRVLHEENLGNFNKMIKQALKTTSQSGVAVENVMDEIVKSVNVFV
SLTNICKIHEKVAMHAMAVKYGGRFIDAFLKAFNFLETQFGQHGGDIVKMIKELQKATRI
IQTICAEAKGYKRTMITSKIPATKRSMERFLFQVKALLEHCSNVERCWIGNLKHKDLHGH
VVSSQVYGDVDDDPNDAEQEQMETDPETPADENDNIVGDDETENEATPLED
NT seq 4476 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttctgcagcgcagcaacccgcgaaagcggccaccaccggcgcccacagcaccc
gggccgccgccgccgccgtcagcgacaccgtccgcgcccaccccggccgaaccctccgtc
gtcgacgcggcggccgcgctccttgcggacgccggctgcacgctcctcgtcccgccgcac
ctgcccccttccctcccgtccgcccccaccttcgtaccccgcctcacccgcgcgctcgcc
gcggaccccgcggcagacctccccgcgcgcctcctcgcggggctcgccgccttcgccgag
tcccccacgcggctgcgccagctactcctgcccacctccccgcggtcgctgagcctggcg
cgggtgctcctctccgtgcccgcgctccagcccggtctcctggggctcctcctcgacaag
ctacccgagcacttcgacgacgacgcgctcgatggggtgcctctgcaggacgacgtgggg
aggcttatcgttgctcagttccgctggcttgatttccttgtcgacgccgatacctttgtc
accaagcttgtggaggtgctctcggtagcgccaccccggctcaagaaggagatcatcggg
tcgatcccggagattgtgggcgaccagagccatgctgctgtggtctccgctctggagaag
ctgctgcaggaggactcccaagtcgtggttgctgtgctcgacactttgtcaaaccttaac
ctcgatgcgctgttgcaggagcaggcggttacagttgcaatatcatgcatccggacgatt
catgcagatcagatgccacacttactcaggttcttgttgctgtctgccacaccagccaat
gttggcaggattatatcgcagatccgcgagcaactgaagtttgttggtgtggtggatcca
cgtgctgctcggagcaagaagctgaaagggaaggcatcagcaactagcactgatggggca
atccttgatgccttgagatcaggcctccggtttaagaatatgctttgtgaggccttcttg
aaggagttgaaattagttgaccatgcaagggatcacaaagtgattgatgtttggctcatc
atgctcatatatgccaatgggggtgctctgcagaaaagtgctgagaaaatactgaaatcc
aagatcttacaaggatatatccgggagacattgtttcaccaatgcattcatggaaatact
gaaatagtaaaggacaattttatgtcatatctctcagtgagtgattacctcttggcttgc
aaggaagacaaggctagagaatttgctacctatttgttcacggctttgtttgaagaattc
agtgatactttctccaggcaagagctcgtaggctcattgataactcatataggttctggg
gtcagttacgaagtttcttctgctttggatattatgatttctttgacatccaacaactct
gaggaactcatccctatagcttcacatataactggtattttagattatctggagagtttt
catgaagataatcttcgaaaggtttacgagatcttctgtcaattggcactggctgctggc
ttcaatactagttcaggtggctcttctgttgctaatgaacttcttatggtagtgagaaaa
caggttagcaatccagatatgaagtataagagaatgggaataattggggctttaaggata
gtttcagctattgcagatgcaaatgctgctgtgaactactcatcatctcagcaaccaaat
tgtgaggaggccctgggactgctaaatatgactgttaactcctgcaaatttgtgacgttg
cccttaattcttctctatgatgaattatcagctttatttgagagcaatgttcttcattct
gcaattattgagtgggttggagaacatgttgcagaatttgataccctttttcttgctgat
cttgaggatggccagctatcagaaaaatatctctgcgagagcattgaaggggaattatgg
atgaacttggatggaaatatctccccagtatgcgtaaatattttgccactagtgtccacc
tcgcaacaaaggtctcaagcctgcttgcagatccttccttcccaatttctacttctaact
accattgaacgttcaggaagtgaaggctcacttggtggaataaatgcactccttggctgt
cctttgcatcttccctctacaaagaacctggatgaatctagatggggaagcttgtcagca
ctggagaaaaaaacagtgtgtcactcactgtactttgcgataaactggattagggagttg
cttaatgccttcagcacacaagttgcggccagagttgataatgtgtcacaaagagtaagg
gatgagacagcagttaaacttttgaagcgtctgagaaatctaatattactcgagattttg
ttaaacacccttcttaaaatttatcctctatctctacctgagctgcgatatcttgggaat
tattctgggtcaactagcagcagcaagttcaacactgggaagaaaattgaggaagacaac
atggagggcccatcttccaacaaaagacaaaagggccgcaaggacaaagcagcttcagat
aaattgaattctgatgagaagctcaagcaatctacgatactggatgctttcaaaagagca
ggtgtaacgatcacccaagaaacaaagaaagcatcttcacgaccattgccaagtggaatg
acgtcgaaggatgttgaaagtgaggctaataatcctggtgagcttgggcatatagatttg
atggcagcaccagttcagctggatatgcaaagatttaaattcagaacactccatgtgaat
tgtttatccttattaaagtattcagagtttcaagattcaacttatccatatcatgaatct
gagctgcctttatatctctatcttctacgtgatctaaacaacaaactagatcatgtaaac
ccatcaagcaagccattttttaacaattctcaagcaaaatccactcgcgctcattgccaa
aagagcacagaagatcttcttagcaaaatccagccactattctcgagtctacggaagcat
ctagacggatcagtttcaatgatgaaagacagatcagatagcagcccagacaactggagt
tcacattcggattcagcaggaaacccgcacataccatacgtgatggtctccaagtcttca
atagccacttccgtatttaaggaggttcttggctgctacaggaagctacttggcacgcca
gatctattgaatcaagcaaatatgtcagctctgaaggagctgctacagactttccagcca
actgaaaatttcgatgatgatctttctgagttccgtccacctctggtccctagtaatgtt
gattatctgtactgtggggcatttaaaatgtttgaggctattatggatgcagtgtgtttg
ttctcacacattttggcctctgacgtgctaattaccatgcaatctattttaaattccatt
atcgtgctgttggaaaaatctggggaatcaaatgggaagaatatgcatggaggatgctcc
aaagagattattccctttgtaaagaagcagcttgggttatcagctcataagctgctaact
tctgatttccctaatgaagatactgaaaatggatggcagagtaaaggtgatcttatagca
aggatattacaaatatacctcaggaatagtgagtcgacttcagttctgcttgatgagctg
gcttgcttggtgttgcctcaggtagcttcgctcaaaagtaaaagtactacccaagaactg
tcgcatgggtttccaacattgtgttcttccactttccactcgtggtgccgtgtgctgcat
gaggagaatcttgggaattttaacaagatgatcaagcaagccttgaagactacatcacaa
tcaggagtagcagtggaaaatgttatggatgaaattgtcaaatcagtaaacgtgtttgtt
tctctgacaaatatatgtaagattcacgagaaggttgctatgcatgcaatggcagttaaa
tatggggggcgattcattgatgcatttcttaaagccttcaactttctagagacgcagttt
gggcaacatggcggcgatatagttaaaatgataaaagaacttcagaaagcaacaagaata
atccaaactatatgtgcagaggcaaagggttacaagcgaacaatgatcacgagcaagata
cctgccacaaagagatccatggagcggtttctcttccaagtgaaggccctcctggaacac
tgctctaatgtggagcgttgctggattggtaatctgaagcacaaggatttgcatgggcat
gtggtaagctctcaggtgtacggtgacgtggatgacgacccaaatgatgcagaacaagaa
cagatggagactgatcctgaaactccagccgacgaaaatgacaacatcgtgggtgatgat
gagacagaaaacgaggcaacaccattggaggattga

DBGET integrated database retrieval system