KEGG   Aegilops tauschii (wheat D): 109773894Help
Entry
109773894         CDS       T04345                                 

Gene name
LOC109773894
Definition
(RefSeq) acetyl-CoA acetyltransferase, cytosolic 1-like
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00071  Fatty acid degradation
ats00072  Synthesis and degradation of ketone bodies
ats00280  Valine, leucine and isoleucine degradation
ats00310  Lysine degradation
ats00380  Tryptophan metabolism
ats00620  Pyruvate metabolism
ats00630  Glyoxylate and dicarboxylate metabolism
ats00640  Propanoate metabolism
ats00650  Butanoate metabolism
ats00900  Terpenoid backbone biosynthesis
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
ats01200  Carbon metabolism
ats01212  Fatty acid metabolism
Module
ats_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    109773894 (LOC109773894)
   00630 Glyoxylate and dicarboxylate metabolism
    109773894 (LOC109773894)
   00640 Propanoate metabolism
    109773894 (LOC109773894)
   00650 Butanoate metabolism
    109773894 (LOC109773894)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109773894 (LOC109773894)
   00072 Synthesis and degradation of ketone bodies
    109773894 (LOC109773894)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109773894 (LOC109773894)
   00310 Lysine degradation
    109773894 (LOC109773894)
   00380 Tryptophan metabolism
    109773894 (LOC109773894)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    109773894 (LOC109773894)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ats04147]
    109773894 (LOC109773894)
Enzymes [BR:ats01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     109773894 (LOC109773894)
Exosome [BR:ats04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109773894 (LOC109773894)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: XP_020188214
Position
Unknown
AA seq 398 aa AA seqDB search
MSSDARDVCVVGVARTPMGSFLGGLSSLPATKLGSIAIEAALRRANVDPSLVQEVFFGNV
LSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIQLGINDIVVAGGME
SMSNAPKYIAEARKGSRFGHDSLVDGMLKDGLWDVYGDYAMGVCAELCADNHALTREDQD
AYAIQSNERGIAARDSGAFAWEIVPIEVPVGRGKPAVLVDKDESLDKFDAAKLKKLRPAF
KDNAGTVTAGNASSISDGAAALVLVSGKKAQELGLHVLARIKGFADAAQAPELFTTTPAL
AIPKALTNAGLESSRVDFYEINEAFSAVALANQKLLGIPSEKINVHGGAVSLGHPLGCSG
ARILVTLLGVLREKSGKIGVAGVCNGGGGASALVMELA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagttcagacgccagagatgtatgtgttgttggggttgcacgcacccctatgggtagt
ttccttggtggcttgtcttccttgcctgctacgaaacttggctctatagcaattgaagct
gctctgagaagggcaaatgtcgatccatcccttgtgcaggaggtcttctttggcaatgtc
ttgagtgctaacttggggcaagctcctgcaagacaagctgctttaggtgcagggatacca
aatacggttgtttgcaccacagtcaacaaagtttgcgcatctggcatgaaagcgaccatg
tttgctgcgcaatcaattcaactgggaatcaatgacattgttgtggcaggtgggatggaa
agcatgtcgaatgctccgaaatacattgctgaagctagaaaaggatctcgtttcggacat
gacagcctcgttgatggcatgcttaaggatggcctttgggatgtatacggtgattatgct
atgggagtgtgcgctgagctttgtgctgacaatcatgccctgacgagggaagaccaggat
gcatatgctattcaaagtaatgagcgtggaattgctgctcgtgacagtggtgcttttgca
tgggagattgttccgattgaagttcctgttggtagagggaaacctgcagtgcttgttgac
aaagatgagagcctagacaagtttgacgcagccaagctgaagaagctacgaccagcattc
aaggataatgctggtactgttactgctggaaatgcttctagtataagtgatggtgctgca
gcattagtattggtgagtgggaagaaggctcaagaacttggattgcatgtccttgcaagg
atcaagggatttgccgatgcagcccaagctcctgaactatttaccactaccccagcactt
gccataccaaaggctctcacgaatgctggcctagagtcctcccgtgttgatttttatgaa
atcaacgaagccttttcggctgttgcacttgcaaatcaaaagcttctcggaattccttca
gaaaagataaatgtacatggaggagctgtatctttaggacacccacttgggtgcagtggt
gctcgcattttggtcacccttcttggtgttcttagggagaagagtggcaagatcggagtt
gctggtgtctgcaacggcggtggcggtgcatctgcgctcgttatggagctcgcgtaa

DBGET integrated database retrieval system