KEGG   Aegilops tauschii (wheat D): 109776735Help
Entry
109776735         CDS       T04345                                 

Gene name
LOC109776735
Definition
(RefSeq) nicotianamine synthase-like 5 protein
  KO
K05953  nicotianamine synthase [EC:2.5.1.43]
Organism
ats  Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:ats00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109776735 (LOC109776735)
Enzymes [BR:ats01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.43  nicotianamine synthase
     109776735 (LOC109776735)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAS Methyltransf_25 Hairy_orange
Motif
Other DBs
NCBI-ProteinID: XP_020190991
Position
Unknown
AA seq 328 aa AA seqDB search
MGCENKEAAALVKKIAGLHAAISKLPSLSPSPEADALFTALVAVCTPPSAAVDVATLGPR
ARRMRADLVRLCADAEARLEAHCSDALAALDAPLDHLRLFPYHDNYVRLGELEHALLSRH
APDHLAVPARVAFVGSGSLPLSALLLAARHMPDAAVDCFDRCGAANERARRLLLRGNDGG
GAASRMTFRTADVEELTHELAAYDVVFLAAPVGVTPEEKARVIAHLGRHMAAGAALVVRS
AHGARGFLCPVVEPAEVRRGGFQVLAVHHPDNSEMVYSVIVARKGYLELVPPAVSPPCNC
CEVEKARGSVPSTSCHLDAMDEIRRRAW
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcgagaacaaggaggcggctgccctggtgaagaagatcgccggcctccacgcc
gccatctccaagctgccgtcgctgagcccgtctcccgaggcggacgcgctgttcaccgcc
ctcgtggccgtgtgcaccccaccgagcgccgccgtcgacgtggccacgctgggcccgagg
gcccggaggatgcgggccgacctcgtccgcctctgcgccgacgcggaggcgcgcctcgag
gcgcactgctccgacgcactcgccgccctcgacgccccgctcgaccacctcaggctcttc
ccctaccacgacaactacgtccggctgggcgagctggagcacgcgctgctgtcccgccac
gcgccggaccacctcgcggtgcccgcgcgcgtcgcgttcgtcgggtccggctcgctgccg
ctcagcgcgctcctgctcgccgcacgccacatgccggacgcggccgtcgactgcttcgac
cggtgcggcgcggccaacgagcgcgcgcggaggctgctgctccgcgggaacgacggcggc
ggcgcggcctcgcgcatgacgttccgcacggcggacgtcgaggagctgacgcacgagctc
gccgcctacgacgtggtcttcctggcggcgcccgtcggggtgacgccggaggagaaagcc
cgcgtgatagcgcacctcggccggcacatggccgccggcgccgccctcgtcgtgaggagc
gcacacggtgcccgtggcttcctgtgccccgttgtggagcccgcggaggtcaggcggggc
gggttccaggtgttggccgtgcaccatcccgataattccgagatggtctactccgtcatt
gtcgcacgtaaaggttacctcgagctcgtgccaccggcggtgagcccgccgtgcaactgc
tgcgaggtggagaaggcgcgcggcagtgtgccgtcaacgagctgccaccttgatgccatg
gacgaaatccggaggcgcgcgtggtga

DBGET integrated database retrieval system