KEGG   Aegilops tauschii (wheat D): 109779807Help
Entry
109779807         CDS       T04345                                 

Gene name
LOC109779807
Definition
(RefSeq) beta-glucosidase 5-like isoform X1
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00460  Cyanoamino acid metabolism
ats00500  Starch and sucrose metabolism
ats00940  Phenylpropanoid biosynthesis
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109779807 (LOC109779807)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    109779807 (LOC109779807)
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    109779807 (LOC109779807)
Enzymes [BR:ats01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     109779807 (LOC109779807)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: XP_020194012
Position
Unknown
AA seq 509 aa AA seqDB search
MALSSLLLLLLLSAAHGAAAPPALGFTRSDFPPDFVFGAATSAYQYEGAVAEDGRSPSIW
DTFTHAGKMPDKSTGDIASEGYHKYKDDVKLMADTNLEAYRFSISWSRLVPNGRGAVNPK
GLEYYNNLINELVKHGIQIHVMLYHLDFPQVLEDEYGGWLSPRIVEDFTAFADVCFREFG
DRVSYWTTIDEPNVGPIGSYDSGIFAPGRCSDPFGITKCTAGNSTVEPYIAVHNMILAHA
SATRLYREQYQAVQKGVVGINVYSFWTYPLTNSTVDLEATKRYQDFMFGWTLGPLVFGDY
PQVMKTNVGSRLPSFTKSQSEFVKGAIDFIGINHYYSVYVNDRPLKEGVRDYAADMSVYQ
RGSRTDPATSEYAPTAYPDDPEGLQFVLQYLTEAYGGLPIYVQENGKASANDILDDTDRV
EYLKSYIGSTLDALRNGANVKGYFVWNFLDIFEFLAGYKLGFGMYRVDFDDEARPREARL
SARWYSRFLKNNGISAQSEVDDTGHHAQQ
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggccttatcctccctcttgctcctcctgcttctctcggccgcccatggcgccgcggct
cctcccgctctcggcttcacgcggagcgacttcccgccggacttcgtcttcggcgccgcc
acctccgcgtaccagtatgagggcgccgtggctgaggatggcaggagcccaagcatctgg
gacaccttcactcacgctgggaaaatgccagacaaaagcacgggcgatatcgcttctgaa
ggataccacaagtacaaggacgacgtcaagctcatggctgacacaaacttagaggcttac
agattctccatctcctggtcaaggcttgttccaaacgggaggggggctgtcaatccaaag
gggttagagtactacaataacctcataaatgagctagtgaaacatggaattcaaatccat
gtcatgctttaccatctcgatttcccacaagttttggaagatgagtatggaggatggtta
agccctagaattgtggaggatttcacagcatttgcagatgtgtgcttcagagagtttgga
gacagggtttcgtactggaccacgatagacgaacctaatgtcggcccaatcggatcttac
gatagtggaatatttgcacctggacgttgttccgatccttttggaataacaaaatgtacc
gccgggaactcaaccgtggagccgtacatagcagttcataacatgatactggcacatgca
tcagctacaagactttacagagaacaatatcaagctgtgcaaaagggagttgttggcata
aacgtttactcattttggacttatcctttgacgaactctactgtggatttagaagcaact
aaaagatatcaagacttcatgtttggctggacactaggacccttggtgtttggagattac
ccacaagtgatgaagacgaatgttggttctcgcctcccatccttcacaaaatcccaatct
gaatttgttaagggcgctatcgatttcataggaataaatcattactattctgtctatgtg
aacgatcgccctttaaaggaaggtgttcgtgactatgcagcagacatgtcagtttaccag
agaggttctagaacagacccagcaacaagcgagtacgccccaacggcttatccagacgac
ccagaaggattgcaatttgtgctgcagtacctgacagaagcctatgggggcctccccatt
tatgtccaagagaatggcaaggcatccgcgaatgacattctcgatgacaccgacagggtg
gaatacttgaagagctacatagggagcacactggatgcattaagaaacggagccaatgtg
aaaggttacttcgtgtggaacttcctggacatcttcgagttcctagcagggtacaagtta
gggttcggcatgtatcgtgtcgactttgatgacgaagcgcggccacgagaagccaggctc
tctgctcgctggtactccaggtttctgaaaaataatggcattagtgctcagagtgaggtc
gacgatacaggacaccatgctcaacagtaa

DBGET integrated database retrieval system