KEGG   Aegilops tauschii (wheat D): 109785551Help
Entry
109785551         CDS       T04345                                 

Gene name
LOC109785551
Definition
(RefSeq) probable serine/threonine-protein kinase PBL8
Organism
ats  Aegilops tauschii (wheat D)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-ProteinID: XP_020199726
Position
Unknown
AA seq 492 aa AA seqDB search
MAHGSLDDYFFKPFYRPLLPWSTRLSIVLATAKGLVSLHSAEKPLICGEFNASDILLDSD
NNAKISLSGLRLDTRASDGSVTTTRSRLGTPRGSAPEYVVSGHLTTKCDVYSFGVVLLEI
LITGMKWIDMKRPVKEERDLLEHARPNLEDPVKLAGIMDKALKGIYPVAAAHKAALVTYK
CLHVKPEDRPDMSDVMKTLDLLTDAAVKEDQLPVPAPVSPNSNLHRFTFAELTAATGGFA
SGNKIGSGSFGTVYRGSLEDGIRPGLRAQPVAVKRARADDYHSEEHLKDSIFLGELQPRQ
PSLVKMIGYCYEGLHRLLVYELMGHGSLANYLSNGKSYNNVKLSDLWFARKYGKGDDRNV
YTLITSGYGSAPEYVMSGDFTKKSDVYCFGVVLLEILTGQRLAWLACASEQYPRNLRPRL
RDPLKLGRIMDPVLKDIYPVAVAHDACMVAYRCLHASPGKRPSMLAVVEALDLLVGVTIV
DEVDVGQTSTRP
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcccatggcagcttggacgactacttcttcaagcctttttatcgtcctttgctgcca
tggtcaaccagactaagcattgtcttagctacggcgaaagggctggtgtccctccacagc
gccgagaagcccttgatctgcggcgaattcaatgcctccgacatcctactggactctgat
aacaatgccaagatctcgctctcgggcctgaggctcgacacgagagcgagcgacggctcg
gtcaccaccacgcgctcgcgcctaggaactccgcgcggcagcgcaccagagtacgtcgtg
tccggccatctcaccacgaaatgcgacgtgtacagcttcggggtggtgttgttggagatt
ctgatcacagggatgaagtggatagacatgaaaagaccagtcaaggaggagcgggacctg
ctggagcacgcgcggccgaatctcgaagacccggttaaactggcagggatcatggataaa
gcgttgaagggcatctacccagtggcagctgcacacaaggctgccctggtcacatacaag
tgtctccatgtcaaacccgaggacaggccagacatgtcggacgtcatgaagacgctggat
ctgcttaccgacgctgccgtcaaggaggatcagttgccggtgccggcgcctgtgtcgccc
aactccaacctacacaggttcaccttcgcggagctgaccgccgcgactggagggttcgcc
tcaggaaacaaaatcggcagcggcagtttcgggacggtgtacaggggatccctcgaggac
ggcatccgaccggggctccgagcgcagcccgtcgccgtcaagagagcgcgagccgacgac
taccactccgaggaacatctgaaagattccatattcctgggggagctgcagccgcggcag
ccgagcctggtgaagatgatcggctactgctacgaggggctgcacaggcttctcgtctac
gagctaatgggccatggcagcttggcaaactacctctccaatggtaagtcatataacaat
gtcaagctatcagacctgtggtttgccagaaaatacgggaaaggtgacgatcgtaacgtg
tacacactcataacaagtgggtacggctctgcgccggagtacgtcatgtccggggacttc
accaaaaagagcgacgtgtactgctttggagtggtgttactggagatcctaaccgggcag
aggttggcctggttggcctgtgcttcagaacagtacccgcggaacctacgaccacgtctg
agagacccgctcaagctagggaggatcatggaccctgtgttgaaagacatttacccggtg
gcagtggcacatgatgcttgcatggtcgcgtataggtgccttcacgcaagccccgggaaa
cgtccaagcatgttggctgttgtggaggcgcttgatttgcttgttggtgtcaccatcgtg
gacgaggttgatgttggtcagacaagcacaaggccgtga

DBGET integrated database retrieval system