KEGG   Aegilops tauschii (wheat D): 109785630Help
Entry
109785630         CDS       T04345                                 

Gene name
LOC109785630
Definition
(RefSeq) wall-associated receptor kinase-like 2
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ats  Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:ats00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ats01001]
    109785630 (LOC109785630)
Enzymes [BR:ats01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109785630 (LOC109785630)
Protein kinases [BR:ats01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109785630 (LOC109785630)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Seadorna_VP7 APH
Motif
Other DBs
NCBI-ProteinID: XP_020199816
Position
Unknown
AA seq 345 aa AA seqDB search
MCLQLHAGTIGAIALLSVLVIFLHMERENRKLRDRFNRNGGSFLKTAGIEIFTKEKLDRI
TNKYSCSIGRGAFGKVYKGTTDTGTVVAVKRSIIVNKDRHKDFANEITVQSKIDHPNLVR
LVGCCLETEVPLLVYEFVPKGSLQDVLHGNNDPLPLETRLNIAISSAEGLDYMHSQSQMI
LHGDVKSGNILLDDSFTPKVSDFGTSRLMSINKDHTNWVVGDSSYINPVYMKIGLLTAKS
DVYSFGIVLLELVTRKKARYGENRSLPMDYIKASKDGPTRQMFDDEVSANVEENMECLEE
VGKIAVQCLEEDVNNRPTMGEVKEKLEKCKSQWLQNQGKANEVIP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttgcaattgcatgcaggaacaatcggcgcaatcgcattactgtccgtgctagta
atattcttgcatatggagcgagagaacaggaagctgagggaccgattcaataggaacggc
gggtcgtttctcaagaccgccgggatcgagatcttcaccaaggagaagctggaccgcatc
acaaacaagtacagctgcagtatcggcagaggcgccttcggcaaggtctacaaggggaca
accgacactggtactgttgttgccgtgaagcgctccatcattgtaaacaaagaccggcat
aaggattttgcgaacgagatcacggtccaatccaaaatcgaccacccgaacctggtccgg
ctcgtgggctgctgcctagagacggaggtgcccttgctggtctacgagttcgtccccaaa
gggagccttcaggatgtgcttcacggcaacaacgaccctctcccgctggaaacacgcctc
aacattgccatcagctccgccgaggggctcgattacatgcactcgcagagccagatgatc
ctccacggcgacgtcaaatccggcaacatcctcctcgacgacagcttcacgcccaaagtg
tcggactttgggacgtccaggctcatgtccatcaacaaggaccacaccaactgggtggtc
ggggacagcagctacatcaaccccgtgtacatgaagatcgggctgctcaccgctaaaagt
gacgtgtacagcttcggtatcgtgctgctcgagctcgtcacccgaaagaaggctaggtac
ggggagaatcgtagccttccgatggactacatcaaggcttccaaggatggcccaacaagg
cagatgttcgatgatgaggtttcagccaatgtggaggaaaacatggagtgcctcgaggag
gttggcaagatcgcggtgcagtgtctcgaggaagacgtgaataacaggcctaccatggga
gaagtcaaggagaaacttgaaaagtgcaagagccaatggttgcaaaaccaggggaaggca
aatgaggtaatcccctag

DBGET integrated database retrieval system