KEGG   Aegilops tauschii (wheat D): 109785753Help
Entry
109785753         CDS       T04345                                 

Gene name
LOC109785753
Definition
(RefSeq) beta-sesquiphellandrene synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    109785753 (LOC109785753)
Enzymes [BR:ats01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     109785753 (LOC109785753)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth AF0941-like
Motif
Other DBs
NCBI-ProteinID: XP_020199933
Position
Unknown
AA seq 525 aa AA seqDB search
MATNNSIPPLVQDNVHKPRPYPASQWGDFFLNYKPCTPQQYRSMEGTAEAKKEEVRQIII
DTAKCSDLTQKLELVYTLQRIGVDYHYGNEIDELLCDIYDGHIIEPLDLRTASLQFYLLR
KHGYCVSSDVFSKFIDKNGNIGSTDATSLLGLYNAAYLRTHGEKILDIAMSSTKKILKSI
VNHLDPTIADEIRHHLETPLFRGTNRVETKRYISTYEKNSTRNETILEFAKLDYNLVQGL
YCDELKDLTMWDEHAVEHAPAYMRPFYKGTVASINQIEEDLKLQKNKHAELVKKLFIDAA
NCYHAEVKWRDQKYVPANLEEHLKISAPSTICMQISNIAFLLMGDITSSETIQWAWAYPT
IIRAVCIIARVMNDIVSHEREQASEHMVSTVQTCMNENGCTVEEANEKLNEVVEQAWMDI
CESCIQPTAHPLAVLSRVANLARVTDFLYKHDDGYTLGYSVKGTLDSGWSPIGTWKRGIV
WHQYDTAGQDLVTAVAVLIREGKVEVKSSRGREWRVGEHRLGRRQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccaacaactctatacctcctctggtacaggacaacgtgcacaaaccccggcct
tacccggcgagccaatggggtgacttcttcctcaattacaagccatgtaccccacaacag
tatcggtccatggagggcacggctgaagcaaaaaaggaagaggtgaggcaaatcatcata
gacaccgccaaatgctctgacctaactcagaagctggagcttgtctacacattgcagcgt
attggggttgactatcactatggaaatgagattgatgaactgttgtgtgatatatacgat
ggacatattattgaacctttggaccttcgtacagcttctctgcagttttacttgctcagg
aaacatggttactgtgtatcttccgatgtcttttctaagtttatagacaagaacggaaat
attggaagcactgatgctacatccttgttgggcctctacaatgctgcatacctcagaacc
catggagaaaaaatacttgacattgccatgagttccacaaagaagatcctaaaatctatt
gttaaccatttggacccgacaattgcagacgaaattaggcaccacctggaaactccactt
ttcagggggactaacagagttgaaacaaagcgctacatctcgacctacgaaaaaaattct
acaagaaatgagaccatacttgagtttgcaaagctggactacaacctagtgcaaggtctg
tactgcgatgagctgaaagatcttaccatgtgggacgagcatgcagttgagcatgcccca
gcatacatgaggcctttctacaagggtacagttgcttccataaatcagattgaagaggat
ctgaaacttcagaaaaacaaacatgctgaattggtgaaaaaactgtttattgatgcggca
aactgctaccatgctgaggtgaaatggcgggaccagaagtatgttccagcgaacctcgaa
gagcacctaaaaatttctgcgccaagcactatatgtatgcaaatatcaaacattgcattc
ctattaatgggagacatcacgtcaagtgagactatacaatgggcatgggcatacccaaca
atcataagagccgtctgcatcatcgcccgtgtgatgaatgacattgtatcccacgagcgg
gaacaagcttcggaacatatggtatccaccgtgcagacctgcatgaatgaaaacgggtgc
acggtagaggaggcaaatgaaaagcttaatgaagtagttgagcaagcatggatggacata
tgtgagagctgcatccagccgacggctcatccattggcagtcttgtcaagagtggccaat
ctcgcacgggtgacggatttcctatacaagcacgatgacggatacaccctcggctattcg
gtgaaagggacattggactcagggtggagcccaataggcacatggaagcgcggaattgtg
tggcatcagtacgatacagctggtcaagatctggtaaccgcggtggccgtgctgatccga
gagggcaaggtggaggtgaagagcagcaggggcagggagtggagagtaggggagcaccgg
ctggggagaagacaatga

DBGET integrated database retrieval system