KEGG   Aegilops tauschii (wheat D): 109785842Help
Entry
109785842         CDS       T04345                                 

Gene name
LOC109785842
Definition
(RefSeq) pyruvate decarboxylase 2-like
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00010  Glycolysis / Gluconeogenesis
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109785842 (LOC109785842)
Enzymes [BR:ats01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     109785842 (LOC109785842)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C Bac_rhamnosid_N Cys_rich_CWC
Motif
Other DBs
NCBI-ProteinID: XP_020200023
Position
Unknown
AA seq 600 aa AA seqDB search
METGIGSVDGPKGAPSGAVACPATFPASSPTFVGSPEATLGRHLARRLVQVGVGDVFAVP
GDFNLTLLDYLVAEPGLRLVGCCNELNAGYAADGYARAKGVGACAVTFTVGGLSVLNAIA
GAYSENLPLICIVGGPNSNDYGTNRVLHHTIGLPDFSQELRCFTPVTCYQAVVNNLDDAH
EQIDKAISTALKESKPVYISVSCNLPSVPHPTFSRDPAPYFLAPRMSNQMGLEAAVEATV
AFLDKAVKPVMVAGPKLRVAKAGTAFAELADASGYAVATMPSAKGLVAETLPRFIGTYWG
AVSTAFCAEIVESADAYLFAGPIFNDYSSVGYSFLLKKEKAVIVQPDRVTVGNGPAFGCI
MMKDFLTELGKRLKKNTTAYENYKRIWVPEGQPPESEPGEPLRVNVLFKHVQKMLTGDSA
VIAETGDSWFNCQKLKLPDGCGYEFQMQYGSIGWSVGALLGYAQGATDKRVIACIGDGSF
QVTAQDVSTMLRCGQNSIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNC
WTAKVTCEEELTAAIETATGDKKDCLCFIEVVAHKDDTSKELLEWGSRVSTANSRPPNPQ
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggagacgggcatcggatccgtggacgggcccaagggggcgccgagcggcgcggtggcg
tgcccagcgacgttcccggcgtcgtcgcccaccttcgtcggctccccggaggccacgctg
gggcgccaccttgcgcggcgcctggtgcaggtcggcgtgggcgacgtgttcgccgtgccg
ggcgacttcaacctgaccctcctcgactacctcgtcgccgagcccgggctgcgcctcgtc
ggctgctgcaacgagctcaacgccggctacgccgccgacgggtacgcgcgcgctaagggc
gtcggcgcgtgcgccgtcacgttcaccgtgggcgggctcagcgtgctcaacgccatcgcc
ggcgcgtacagcgagaacctccccctgatctgcatcgtcggcgggcccaactccaacgac
tacggcaccaaccgggttcttcatcacaccatcggcctccccgatttctctcaggagctg
cggtgcttcacgccggtgacgtgctaccaggccgtcgtcaacaacctcgacgacgcccac
gagcagatcgacaaggccatctccacggctctcaaggagagcaagccggtgtacatcagc
gtcagctgcaacctccccagcgtcccccaccccaccttcagccgcgaccccgccccctac
ttcctcgcaccaaggatgagcaaccagatgggacttgaggcggcggtggaggcgacggtg
gccttcctggacaaggcggtgaagccggtgatggtggcggggcccaagctgcgggtggcc
aaggcaggcacggcgttcgcggagctggccgacgcgagcggctacgcggtggcgaccatg
ccgtcggccaaggggctggtggcggagacgctgccacgcttcatcggcacctactggggc
gcggtgagcacggccttctgcgccgagatcgtggagtcggcggacgcctacctcttcgcc
ggccccatcttcaacgactacagctcggtgggctactcgttcctgctcaagaaggagaag
gcggtgatcgtgcagcccgaccgcgtcaccgtcggcaacggcccggccttcggctgcatc
atgatgaaggacttcctgaccgagctgggcaagcgcctcaagaagaacaccaccgcctac
gagaactacaagcggatctgggtgcccgaggggcagccgcccgagagcgagcccggcgag
ccgctgcgcgtcaacgtcctcttcaagcacgtccagaagatgctcaccggcgacagcgcc
gtcatcgccgagacgggcgactcgtggttcaactgccagaagctcaagctccccgacggc
tgcgggtacgagttccagatgcagtatggctccatcgggtggtccgtcggggcgctgctc
gggtacgcgcagggcgccacggacaagcgcgtcatcgcctgcatcggtgacggcagcttc
caggtgacggcacaggacgtgtccaccatgctccgatgcggccagaacagcatcatcttc
ctcatcaacaacggcggctacaccatcgaggtcgagatccacgacgggccatacaacgtc
atcaagaactggaactacaccggcctcgtcgacgccatccacaacggcgagggcaactgc
tggacagccaaggtcacgtgcgaggaggagctgacggcggccatcgagacggcgaccggg
gacaagaaggactgcctttgcttcatcgaggtggtggcgcacaaggacgacaccagcaag
gagctcctcgagtggggatccagggtctccaccgccaactccaggccacccaacccgcag
tag

DBGET integrated database retrieval system