KEGG   Acinetobacter sp. TTH0-4: AMQ28_01510Help
Entry
AMQ28_01510       CDS       T04075                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
att  Acinetobacter sp. TTH0-4
Pathway
att00071  Fatty acid degradation
att00072  Synthesis and degradation of ketone bodies
att00280  Valine, leucine and isoleucine degradation
att00310  Lysine degradation
att00362  Benzoate degradation
att00380  Tryptophan metabolism
att00620  Pyruvate metabolism
att00630  Glyoxylate and dicarboxylate metabolism
att00640  Propanoate metabolism
att00650  Butanoate metabolism
att00900  Terpenoid backbone biosynthesis
att01100  Metabolic pathways
att01110  Biosynthesis of secondary metabolites
att01120  Microbial metabolism in diverse environments
att01130  Biosynthesis of antibiotics
att01200  Carbon metabolism
att01212  Fatty acid metabolism
att02020  Two-component system
Brite
KEGG Orthology (KO) [BR:att00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMQ28_01510
   00630 Glyoxylate and dicarboxylate metabolism
    AMQ28_01510
   00640 Propanoate metabolism
    AMQ28_01510
   00650 Butanoate metabolism
    AMQ28_01510
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AMQ28_01510
   00072 Synthesis and degradation of ketone bodies
    AMQ28_01510
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMQ28_01510
   00310 Lysine degradation
    AMQ28_01510
   00380 Tryptophan metabolism
    AMQ28_01510
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMQ28_01510
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMQ28_01510
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AMQ28_01510
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:att04147]
    AMQ28_01510
Enzymes [BR:att01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AMQ28_01510
Exosome [BR:att04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMQ28_01510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Macoilin
Motif
Other DBs
NCBI-ProteinID: ALD01150
UniProt: A0A0M4GFP1
Position
312582..314093
Genome map
AA seq 503 aa AA seqDB search
MSKTTQENPAVENSATETASNTSKSTARTTKSSGTAKTSANSVTKTTRTRSASPRQSAAN
TKKTESTTQTAVQQDKIMSQNTVRRVAIIGGNRIPFARSNGAYFTASNSDMFTAALNGLV
ERFNLQGQRLGEVVAGAVLKHSRDFNMTRECVLNTELAPETPAYDIQQACGTGLQAAFLV
ANKIALGQIEVGVAGGVDTTSDAPIAFGDGLRKALLELNIAKTGKDRLKALTKINLKDLM
DAPKNGEPRTGLSMGDHQAITTLEWGIAREAQDELAASSHQKMAAAYEAGFFDDLITPFL
GLERDNNLRADSTAEKLAKLKPAFGKGDARTMTAGNSTPLTDGASCVLLASEEWAKANGH
EILAYLSFTETAAVDFVGKKEGLLMAPAYAVPRMLERAGVTLQDFDYYEIHEAFASQVLS
TLKAWEDPKFCKERLGLDAPLGSIDRTKLNVKGSSLAAGHPFAATGGRIIATAAKLINQK
GSGRVLISICAAGGQGVTAIIEK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacaactcaagaaaatccagcagtcgaaaattctgctacggaaactgcgtca
aatacatcaaaaagtactgcgcgtacaactaaaagttctggcactgcaaaaacatcggca
aatagtgtgaccaaaacgactcgaactcgttcagcgtcaccacgtcaaagtgctgccaac
accaaaaaaactgaatctacaactcaaactgctgttcaacaggataaaatcatgagtcaa
aacactgttcgccgcgttgctattatcggtggtaatcgtattcctttcgctcgttcaaac
ggcgcgtatttcactgcttccaactctgatatgtttactgcagcattgaatggtttggtt
gagcgttttaatttacagggtcaacgtttaggtgaagtggttgctggcgctgtattgaaa
catagtcgtgacttcaatatgacacgtgaatgtgtattaaacactgaacttgcaccagaa
acacccgcttacgatattcaacaagcatgtggtacaggtttacaagctgcattcttggta
gccaacaaaattgcactaggtcaaattgaagttggtgttgcgggtggcgtagataccact
tctgatgcaccgatcgcttttggtgatggcttacgtaaagcattgcttgaacttaatatt
gcaaaaacaggtaaagaccgcttaaaagcattaactaaaattaatcttaaagacttgatg
gatgcaccaaaaaatggtgaaccacgtacaggtctttctatgggcgaccatcaagcaatc
actacccttgaatggggaatcgctcgcgaagcacaagacgaattagcagcatcttctcat
caaaaaatggctgctgcttatgaagcaggtttctttgatgatttaattacgccgttttta
ggtttagaacgtgacaataatttacgtgctgactcaactgcagaaaagctggctaaactc
aaaccagcatttggtaaaggcgatgcgcgcaccatgactgcgggtaactctactccatta
acagatggtgcttcttgtgtacttttagcgtctgaagaatgggcaaaagccaatgggcac
gaaattctggcttatttaagctttactgaaactgctgcagtcgatttcgtcggtaaaaaa
gaaggtttattgatggcacctgcttatgcagttccacgtatgcttgagcgtgctggcgtt
actttacaagatttcgattactatgaaattcacgaagcttttgcatcacaagtgctttca
actttaaaagcatgggaagatccaaaattctgtaaagagcgtttaggtttagatgcgcca
ctcggttcaattgaccgcactaaactcaacgtaaaaggttcttcacttgcagcaggccac
ccatttgctgcaacaggcggtcgtattatcgcgactgctgcaaaactcattaaccaaaaa
ggttctggtcgtgtgctcatttcaatttgtgctgctggcggtcaaggtgtaacagcgatt
attgaaaagtaa

DBGET integrated database retrieval system