KEGG   Acinetobacter sp. TTH0-4: AMQ28_03910Help
Entry
AMQ28_03910       CDS       T04075                                 

Definition
(GenBank) nuclease PIN
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
att  Acinetobacter sp. TTH0-4
Brite
KEGG Orthology (KO) [BR:att00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AMQ28_03910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ALD01585
UniProt: A0A0M4GTD3
Position
complement(821861..823480)
Genome map
AA seq 539 aa AA seqDB search
MNSNIPPVQDQVSSAPQKSTNVHVPTPKFFMPVFLTVIIATLVYIGFQLSADLSHVPTLS
LYSVILLATALFIALGFEFVNGFHDTANAVATVIYTNALSAPVAVMWAGFCNFLGVMVAS
GAVAYGIIALLPVELIMNVSSGAGFAMVFAMLIAAILWNLGTWFLGIPASSSHTLIGSIL
GVGIMNYLLNSGGGASGVDMDQVIKVGKALLFSPLIGFAFAAIVFLLIKKVFKKQVELFQ
PPEGNKPPPPMIRAILIFTCTGVSFAHGSNDGQKGMGLIMLILIGIVPLAYSLNKNLDAQ
HIQSFNQLSNQTADILYVNHTAITDETARNTLTTYIQTKEITPEVVPALASLTDHLGDRV
AQYGDLKAIPEAEVSIIRNDMYLSSTAFKRLDKAEQLPAMSQDQGKAIKEYRSKLDSFLQ
YIPTWVKVAVALALGLGTMVGWKRIVVTVGERIGKNHMTYGQGMSAELVAMTTIAAADGF
GMPVSTTHVLNSAVAGTMVANKSGLNFATVKVILSAWIFTLPATICLSGGLYWLFLQFT
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaattctaatattcctcccgtccaagatcaggtttcatcagcgccacagaaatcgacg
aatgtgcatgtgcctacaccgaaattttttatgccggtgtttttaacggtcattattgca
actttggtttacattggttttcagctttctgctgatttgtctcatgttccaactttaagt
ttatattctgttatcttgctggctaccgctttattcattgctttgggctttgagtttgtc
aatggttttcacgacactgcaaatgcagtggcgacagtcatttataccaatgccttatct
gcaccagttgcggtaatgtgggctggtttttgtaattttcttggggtcatggttgcaagt
ggggcagtggcctacggcattattgctttgttgccggtcgagttaattatgaatgttagc
tcgggcgctggttttgccatggtctttgccatgttgattgcagccattctatggaatttg
ggtacttggtttttaggtattcctgcttcaagttcacatactttaatcggttcgatttta
ggtgtgggcatcatgaattatcttttaaattcaggaggtggagcaagtggtgtagatatg
gatcaggtgattaaagtcggtaaggctttgttattttcacctttgatcggatttgctttt
gctgcgattgtatttttactgattaaaaaagtctttaaaaaacaagtagaattgtttcag
ccacctgaaggcaacaagccaccaccaccgatgatccgcgcgattctgattttcacttgt
acaggggtgagttttgctcatggttcaaatgatggtcagaagggtatgggtttaattatg
ttgattctgattggtattgttcctctggcttattctctgaataaaaatctagatgctcaa
catattcaatcttttaatcaactgtcgaatcagactgcagatattttgtatgtaaatcat
acagcaataaccgatgaaacagcgcgtaatacattaaccacatatattcaaaccaaagaa
attacacctgaagtggttccagcattggccagtttaaccgatcatttgggtgaccgtgtt
gcgcaatatggtgacttaaaagccattcctgaagcggaagtttcgattattcgcaacgat
atgtatttgagtagcaccgcatttaagcgtttggataaagctgaacaactgcctgccatg
tcgcaagatcagggcaaagcgattaaagaatatcgcagtaaattagattctttcctgcaa
tatattccaacttgggtgaaggttgcagtcgctctagcattgggcttaggcacaatggtc
ggctggaagcgcattgtggttacagtgggtgagcgtattggtaaaaatcacatgacttat
ggtcagggcatgtcagcagaattggtcgcgatgaccaccattgcggctgcagatggtttt
ggtatgccagtgtcgaccacacatgtattaaacagtgcggttgcgggtacgatggttgcc
aataaatcggggttaaattttgccactgtgaaggtcattttgtccgcttggattttcacc
ttacctgccaccatttgtttatcgggtggtttgtactggttattcttacagtttacttaa

DBGET integrated database retrieval system