KEGG   Acinetobacter sp. TTH0-4: AMQ28_06285Help
Entry
AMQ28_06285       CDS       T04075                                 

Definition
(GenBank) glycyl-tRNA synthetase
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
att  Acinetobacter sp. TTH0-4
Pathway
att00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:att00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AMQ28_06285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:att01007]
    AMQ28_06285
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:att03016]
    AMQ28_06285
Enzymes [BR:att01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     AMQ28_06285
Amino acid related enzymes [BR:att01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   AMQ28_06285
Transfer RNA biogenesis [BR:att03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AMQ28_06285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: ALD02009
UniProt: A0A0M4HB43
Position
1327008..1327991
Genome map
AA seq 327 aa AA seqDB search
MSRAISHIDTFQGLILALQNYWAEQGCVILQPYDMEMGAGTFHTATFLRALGPETWNAAY
VQPSRRPKDGRYGENPNRLQHYYQFQVVLKPNPDNIQQLYLDSLKAIGIDPLVHDIRFVE
DNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGVECYPVTGEITYGLERLAMYLQGVD
SVYDLVWTKGQFGTVTYGDVFHQNEVEQSTYNFEYANVEKMFELFDFYEAEATRLIEAEL
PLPAYEQVIKASHSFNLLDARGAISVTERQRYILRVRTLARSIAQSYVAARAKLGFPMAE
PELRDEVLAQLKAQVEAEAKEANKESK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcgccatatcgcatattgatacatttcaaggcttaattcttgccttacaaaac
tactgggctgaacaaggttgcgttattttacaaccttacgatatggaaatgggcgcagga
acattccacacagcgaccttccttcgtgctttagggcctgaaacctggaatgcagcctac
gttcaaccgtcacgtcgtcccaaagatggccgttatggcgaaaacccaaaccgcttgcag
cactactaccaattccaagtggtgttgaagccaaatccagacaacatccaacagctttat
ttagattctttaaaagccattggtattgatcccctcgttcatgacattcgttttgtcgaa
gacaattgggaatctccaacactcggtgcttggggcttaggttgggaagtttggctaaat
ggtatggaagtgactcagttcacttacttccaacaagtcggcggtgttgagtgctaccca
gtcacaggcgaaatcacctatggtcttgagcgtcttgcgatgtacttacaaggtgttgat
tcggtttacgatttagtttggactaaaggtcagtttggtactgtgacttatggcgatgtg
ttccatcaaaacgaagtagaacaatcgacgtataacttcgaatacgcaaacgttgaaaaa
atgtttgaattgttcgatttctacgaagcggaagcaacacgcttaattgaagcagaactt
ccacttcctgcttatgaacaagtcatcaaagcatcgcatagctttaacttgctcgatgca
cgtggtgcaatttcagtcactgagcgtcaacgttatatcttacgtgtacgcactttggcg
cgttcaattgcacaaagttatgtggctgctcgtgcgaaactcggtttcccaatggcagag
cctgaacttcgtgatgaagttttggcacagttaaaagcacaagttgaagcagaagcgaaa
gaagcaaacaaggagagcaaataa

DBGET integrated database retrieval system