KEGG   Acinetobacter sp. TTH0-4: AMQ28_08600Help
Entry
AMQ28_08600       CDS       T04075                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
att  Acinetobacter sp. TTH0-4
Pathway
att00480  Glutathione metabolism
att00590  Arachidonic acid metabolism
att01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:att00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AMQ28_08600
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AMQ28_08600
Enzymes [BR:att01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AMQ28_08600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ALD02410
UniProt: A0A0M4GUT9
Position
1820801..1821283
Genome map
AA seq 160 aa AA seqDB search
MTTIYDFQAEMLEGEQKNFSEYQGKVLLIVNTASQCGLTPQFEGLEQLYQDYQSKGLIIL
GFPCNQFAHQDPLTNEEIGGFCQRNYGVSFPMFAKVDVNGSKAHPLYQYLTAEAKGILGS
QKIKWNFTKFLINQEGKVIKRYAPLIKPEKIAKDIQKLLS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaatttatgattttcaggctgaaatgttagaaggcgagcagaaaaatttttct
gaatatcaaggtaaggttttactgattgttaataccgcaagccaatgtggtttgacccca
caatttgaaggcttagagcagctttatcaggactatcaatcaaaaggcttaattatttta
ggctttccctgtaaccagtttgcccatcaagatccattaacgaatgaggaaatcggtggc
ttttgccaacgtaactatggagtatcatttccaatgtttgccaaagtagatgtcaatggt
tcgaaggcgcatccgctttatcagtatctgactgcggaagcgaagggcatattgggtagt
caaaagattaaatggaattttacaaaatttttgattaatcaagaaggtaaggtgattaaa
cgttatgcacctttgattaagccagaaaaaattgccaaagatattcaaaaacttttatct
taa

DBGET integrated database retrieval system