KEGG   Acinetobacter sp. TTH0-4: AMQ28_10210Help
Entry
AMQ28_10210       CDS       T04075                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
att  Acinetobacter sp. TTH0-4
Pathway
att03010  Ribosome
Brite
KEGG Orthology (KO) [BR:att00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AMQ28_10210
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:att03011]
    AMQ28_10210
Ribosome [BR:att03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AMQ28_10210
  Bacteria
    AMQ28_10210
  Archaea
    AMQ28_10210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ALD02695
UniProt: A0A0M5JT57
Position
2152954..2153283
Genome map
AA seq 109 aa AA seqDB search
MEVTAKLRGAAISAQKARLVADLIRGKSIAHALNILNFSNKKAAAIVKKALESAVANAEH
NNSLDVDDLKVSTIYVDEGVSLKRIMPRAKGRADRITKRTCHITVKVGV
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagttactgctaagttacgcggtgccgctatctcggcacaaaaagcacgtttggtt
gcagatttaatccgtggcaaatctattgcccacgctttaaatatcttgaacttcagcaat
aaaaaagctgcagcgatagtgaaaaaagcattggaatctgcagttgcaaacgctgaacac
aataacagtttagatgtagacgaccttaaagtttctacgatctacgttgatgagggcgtt
agcctgaaacgtattatgccacgtgccaaaggccgtgcagatcgtattactaagcgtact
tgtcacatcaccgttaaggtaggggtttga

DBGET integrated database retrieval system