KEGG   Acinetobacter sp. TTH0-4: AMQ28_11625Help
Entry
AMQ28_11625       CDS       T04075                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
att  Acinetobacter sp. TTH0-4
Pathway
att00450  Selenocompound metabolism
att00970  Aminoacyl-tRNA biosynthesis
att01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:att00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AMQ28_11625 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AMQ28_11625 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:att01007]
    AMQ28_11625 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:att03016]
    AMQ28_11625 (metG)
Enzymes [BR:att01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AMQ28_11625 (metG)
Amino acid related enzymes [BR:att01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AMQ28_11625 (metG)
Transfer RNA biogenesis [BR:att03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AMQ28_11625 (metG)
 Prokaryotic type
   Other AARSs
    AMQ28_11625 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f tRNA-synt_1d
Motif
Other DBs
NCBI-ProteinID: ALD02943
UniProt: A0A0M3RLW3
Position
complement(2435924..2437984)
Genome map
AA seq 686 aa AA seqDB search
MRNILVTNALPYANGPIHMGHLLGYIQADIWVRAMRAMGHDVAYVCADDAHGTAIMLRAE
ANGISPEQQIANVQKEHIRDFDGFGVHFDHYDSTNSEENKNRSSEIYIKNREAGNIAIRP
VTQLFDPEKSMFLSDRFIKGTCPKCKAEDQYGDACEVCGTTYNAIELIEPKSTLSGATPI
EKSSDHYFFKLPNFAEYLQKWTRDEGRLPVSIANKLDEWFENGLNDWDISRDAPYFGFEI
PDAPNKYFYVWVDAPIGYMSSFENYIKTKRPDLNFDDYWKKDSENEVYHFIGKDIVYFHA
LFWPAMLEGANYRTPSGLFVNGFLTVNGQKMSKSRGTFIKAETYLEHLNPEYLRYYFASK
LSDKVEDSDLNLDDFVQKVNSDLVGKVVNIASRCAKFINTKFDNKLSATCAEPELVQNFI
DAGASIASQYEAREFSAAIREIMSLADKANQYIDEKKPWALAKIEGEEQQVHDVCSVGIN
LFRQLAVYLSPVLPTLAAQVQDFLKLDRFDFASAQTALVDHEIALFKPLMQRVDPKAVAA
MVDASKDSLAAAAEPVKIEKKKEKKIVEKKPEPKVGEAEIIGIEDFMKVDLRVAEVLKAA
TVEGSDKLLQLTLNVGEAEPRNVFSGIREFYAPEDLKGKLVVMVANLAPRKMRFGISNGM
VLAAGNGDGVWVISPESGAKPGDKVS
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaatatcttagtcaccaacgccctaccatacgccaatggccccattcatatgggt
cacttgctcggttatatccaagctgatatttgggttcgtgcaatgcgtgcaatgggacat
gacgtggcttatgtctgtgcggatgatgctcacggtacagccattatgcttcgtgcagaa
gccaatggcatttcaccagaacaacaaattgccaatgtgcaaaaagaacatatccgtgat
tttgacggttttggtgtacattttgatcattacgattcgaccaatagtgaagaaaataaa
aatcgatcgtctgagatttacatcaaaaaccgtgaagcaggcaatattgcaattcgtcct
gtgacgcaattgtttgatcctgaaaaaagtatgtttttatcggatcgttttattaaaggc
acctgcccgaaatgtaaagcggaagaccaatacggcgatgcctgcgaagtctgcggcacg
acgtataatgcaattgagttgatcgaacctaaatcgactttaagtggtgcaacaccaatt
gaaaaatcgtctgatcattacttctttaaacttccaaattttgctgaatatctacagaaa
tggacacgagatgaaggtcgtctccctgtttctattgccaacaagctggatgaatggttt
gaaaatggcttaaatgattgggatatttcacgagatgcgccatatttcggttttgaaatt
ccagatgcgccaaacaaatatttctacgtttgggttgatgcgccaattggttatatgtcg
agttttgaaaactacattaaaaccaaacgtccagacttaaacttcgatgattattggaaa
aaagattctgaaaatgaggtctatcatttcattggtaaagacattgtttacttccacgcg
ctgttctggcctgcaatgcttgaaggtgcaaattaccgtacgccatcgggtttattcgtc
aatggtttcttgactgtaaacggtcaaaaaatgtcgaaatcacgtggtacatttattaaa
gctgaaacctaccttgaacatttaaaccctgaatatttacgttattacttcgcgtctaaa
ctgtcggataaagttgaagattctgatttgaacttggatgatttcgttcagaaagtgaat
tcagacttggtcggtaaagtggtgaatattgctagccgttgtgccaagtttatcaatact
aagtttgataataagctaagtgcaacctgtgcagagccagaactcgttcaaaactttatt
gatgcgggtgcttcaattgcatctcagtatgaagcgcgtgagttttctgcggcgattcgt
gaaatcatgtcattggcagataaagcaaaccaatatattgatgagaaaaagccttgggcg
cttgcaaaaattgaaggtgaagagcaacaagtacatgatgtatgttctgtggggattaac
ctcttccgtcaattggctgtttacttgtcccctgtactaccaactttagcggctcaagtt
caagacttcttaaaattagaccgctttgactttgcttctgctcaaacggcattggtcgat
catgaaattgcattgttcaaaccgttaatgcagcgtgtagacccgaaagcggttgcggca
atggtcgatgcatctaaagactctttagctgctgcggctgaacctgtcaaaattgaaaag
aaaaaagaaaagaaaattgttgagaaaaaacctgagcctaaagtcggtgaagcagagatc
attggcattgaagactttatgaaggttgacctgcgtgttgctgaagttttaaaagctgca
acagtagaaggctctgacaaattgcttcaattaactttaaatgtcggtgaagctgaacca
cgtaatgtattcagtggtattcgtgagttctatgcccctgaagaccttaaaggtaaatta
gtggtaatggtcgcaaaccttgcaccgcgtaaaatgcgttttggtatttcaaatggtatg
gtacttgcagcgggtaatggcgatggtgtttgggtgatttcacccgaatctggtgctaag
ccgggtgataaagtgtcttaa

DBGET integrated database retrieval system