KEGG   Acinetobacter sp. TTH0-4: AMQ28_13965Help
Entry
AMQ28_13965       CDS       T04075                                 

Definition
(GenBank) dihydropteridine reductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
att  Acinetobacter sp. TTH0-4
Pathway
att00633  Nitrotoluene degradation
att01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:att00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AMQ28_13965
Enzymes [BR:att01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     AMQ28_13965
  1.-  
   1.-.-  
    1.-.-.-  
     AMQ28_13965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: ALD03349
UniProt: A0A0M4GTT8
Position
complement(2902551..2903204)
Genome map
AA seq 217 aa AA seqDB search
MDLLNISKTRYTTKAYDPDRKIPSEQITRLLEVLRLTPSSINIQPWHFFIADHQIAKERI
AKALVGKYAYNAPKVLDSSHTILFCTQADISEQHLENLLQQDDASGRFKDSTAKQGQKDS
RSGYVDYYRNEKGDIQRWAENQTFIALGQILLAAGIEGIDATPIGGFDEQIINDELKLTE
KGLVPSVLLTLGYRSESDFNAKLPKSRLNKETIFTQL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttaaacatttcaaaaactcgctataccaccaaagcttatgatcctgatcga
aaaattccatctgaacagattacgcggctattagaagtactccgtttaacaccctcttcg
attaatattcaaccttggcatttttttattgcagatcatcaaatagccaaagagcgtatt
gccaaggcattggtcggcaaatatgcgtataacgcacccaaagttttagattcgtcccat
accattttattttgtacgcaagctgatattagtgaacagcatttagaaaatctactccaa
caagatgatgcaagtggccgttttaaagactcaactgcgaaacaaggtcaaaaagacagt
cgcagtggttatgttgattattatcgtaatgaaaaaggtgatattcaacgttgggcagaa
aatcaaacctttattgctttaggtcaaattttactggctgctggcatcgagggtattgat
gccacaccgattggtggcttcgatgagcaaattatcaatgatgaactaaaactgacagaa
aaaggtttagtaccttctgtacttttaacactcggatatagaagcgaaagtgatttcaat
gccaaattgccaaaatcacgtctcaataaagagactatttttactcagctttaa

DBGET integrated database retrieval system