KEGG   Agrobacterium fabrum: Atu4373
Entry
Atu4373           CDS       T00070                                 
Symbol
cytR
Name
(GenBank) transcriptional repressor, LacI family
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
atu  Agrobacterium fabrum
Brite
KEGG Orthology (KO) [BR:atu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:atu03000]
    Atu4373 (cytR)
Transcription factors [BR:atu03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    Atu4373 (cytR)
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 Peripla_BP_4 LacI HTH_23 HTH_38 HTH_31 HTH_IclR HTH_24 TnsD
Other DBs
NCBI-ProteinID: AAK89067
UniProt: A9CGI7
Position
linear:1510218..1511240
AA seq 340 aa
MSKDQGSNIREVAALAGVSIATVSRALQQPDKVRPETRKKVFDAVRQANFVPNAQAASFR
RQSNNTVILLVRDIGNPFYLEIYKGVEEAAGEAGFKVLMGDARNDEHRVATHIDMVRQKH
ADGLILMTGQFPSELLDQADALPPIVIASETVPGLALPTVKVDNRAASMNAMRHLIAAGH
QRIVHLAGPVPESLAQERFDGYRAALAEAGIAYADELVVTGDYSIEAGRQAIAGLLEGGI
AFTAIFASSDQMAIGAISELRGRGLSVPADVSVIGFDDIIFANAFEPPLTTVRQPRQEMG
RRAMALMVDRLNGKRTAETIVLDTELVVRGSVAPCRPPHR
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagcaaagaccaaggttcgaatatcagggaagttgcagctctcgcgggcgtttccatc
gcgaccgtatcgcgggcgctgcaacaacccgacaaggttcgcccggaaacccgaaagaag
gttttcgacgccgtccggcaggcgaacttcgttcccaacgcccaggccgcaagcttccgg
cgtcaatccaacaacaccgtcatccttctcgtccgagatatcggcaacccgttttatctc
gaaatctacaagggtgtggaagaagcagccggcgaagcaggtttcaaggtcctgatgggt
gacgcccgcaatgacgaacaccgcgtggcgacccatatcgacatggtcaggcagaaacat
gccgacggcctgatattgatgaccggacagtttccgtccgagcttctcgatcaagccgat
gcgctgccgccgattgtcatcgcgtcggagacggtgccgggcctcgcgctgccgaccgtc
aaggtggacaaccgtgccgcctccatgaatgccatgcgccacctcatcgctgcggggcat
caaaggatcgtgcatcttgctggccccgttccggaaagcctggcgcaggaacgtttcgat
ggttaccgcgcggcacttgccgaggccggtatcgcttatgccgacgaacttgtcgtgacg
ggcgattacagcattgaggccggccgccaggcgattgccggtcttctcgaaggtggcatc
gccttcaccgcgatcttcgcatcgagcgaccagatggcgattggcgcgatcagcgagctg
cggggcaggggtctctcggttccggctgacgtctccgtcatcggcttcgacgacatcatc
ttcgccaatgccttcgaaccgccgctgacgacggtacgtcagccccggcaggaaatgggc
cgcagggccatggcgctgatggtggaccggctgaacggcaaacgcacggcagaaaccatc
gtgctggatacggaacttgtggtgcgcggctcggtcgcgccctgccgcccgccgcatcgg
tag

DBGET integrated database retrieval system