KEGG   Agrobacterium fabrum: Atu0184Help
Entry
Atu0184           CDS       T00070                                 

Gene name
glk
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
atu  Agrobacterium fabrum
Pathway
atu00010  Glycolysis / Gluconeogenesis
atu00052  Galactose metabolism
atu00500  Starch and sucrose metabolism
atu00520  Amino sugar and nucleotide sugar metabolism
atu00521  Streptomycin biosynthesis
atu01100  Metabolic pathways
atu01110  Biosynthesis of secondary metabolites
atu01120  Microbial metabolism in diverse environments
atu01130  Biosynthesis of antibiotics
atu01200  Carbon metabolism
Module
atu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Atu0184 (glk)
   00052 Galactose metabolism
    Atu0184 (glk)
   00500 Starch and sucrose metabolism
    Atu0184 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Atu0184 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Atu0184 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Atu0184 (glk)
Enzymes [BR:atu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Atu0184 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-GeneID: 1132222
NCBI-ProteinID: NP_353219
UniProt: Q8UIV7
Position
circular:complement(186737..187759)
Genome map
AA seq 340 aa AA seqDB search
MPKTSDTEYLSFPILLGDIGGTNARFSILIDSFAEPVHLTTVKTAEYPGIDDAIQQAVLD
KTSLQPVSTILAIAGPIEGDEIPLTNCHWVVKPKDMLAKLGLKDVIVINDFEAQALAIAA
LDDDNREPIGSGKKDMLASRVVLGPGTGLGVAGLVYARHMWFPVPGEGGHIDIGPRSARD
YVVFPHIETIEGRVAGEQILCGRGLVNLYRAICKADGIEPVFSDPADITSQGLSGQNAQA
KETLSLFSTYLGRVAGDLALIFMAKGGVYLAGGISQKIIPALKSPEFRAAFEDKAPHSAL
MRTIPTFVVTHPQAALSGLATYARTPADFGLALDGRRWRA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagacgtccgataccgaatatctgtcctttccgatccttcttggcgacatcggc
ggcaccaatgcccgcttttccatcctgatcgattcctttgctgaaccggtgcacctcacc
acggtgaagacggcggaatatcctggtatcgatgacgcgatccagcaggcggttctggac
aagacctctcttcagccggtctcgaccattcttgcaattgccggcccgatcgaaggcgac
gagattccgttgaccaactgccactgggtcgtcaagccgaaggacatgctggccaagctc
ggcctgaaggacgtcatcgtcatcaacgactttgaggcgcaggctctggcgattgcggct
cttgacgacgacaaccgggagcctatcggctccggtaaaaaggacatgctggcgtcgcgc
gtcgttcttggaccgggcacggggcttggcgtcgccgggctggtctatgcccgccatatg
tggtttccggtgcctggcgaaggcgggcatatcgatatcggcccgagaagcgcgcgcgac
tatgtggttttcccccatatcgaaaccatcgagggccgcgtcgccggcgaacagatcctg
tgcggacgcgggctggtcaatctttatcgggccatctgcaaagccgacggcatcgagcct
gtcttttccgatccggccgacatcacctcgcaggggctttcgggccagaacgcgcaggca
aaagaaacgctgtcgctgttcagcacctatctcggccgcgtggcgggcgaccttgcgctg
atcttcatggccaagggcggcgtttatctggccggcggtatttcgcagaagatcatccct
gcgctgaagagcccggaattccgggcggcgttcgaagacaaggcgccgcacagcgctctg
atgcggaccattccgacattcgtcgtcacccatcctcaggcggccctttccggcctcgcc
acctatgcgagaacgcctgccgatttcggtcttgcgctggacgggcggcgctggagggct
tga

DBGET integrated database retrieval system