KEGG   Agrobacterium fabrum: Atu0326Help
Entry
Atu0326           CDS       T00070                                 

Gene name
ham1
Definition
(RefSeq) putative deoxyribonucleotide triphosphate pyrophosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
atu  Agrobacterium fabrum
Pathway
atu00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:atu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Atu0326 (ham1)
Enzymes [BR:atu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     Atu0326 (ham1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-GeneID: 1132364
NCBI-ProteinID: NP_353358
UniProt: Q8UIG9
Position
circular:complement(320384..321028)
Genome map
AA seq 214 aa AA seqDB search
MRKLDTRTIVVASHNKGKIAEIADLIGPFGFSAKSAAELNFSEPEETGTTFEENAAIKAL
ASAKASGLPALSDDSGLVIDALDGAPGVYTANWAETADGTRDFAMAMQKVEDALAERGAS
KPEDRTARFVSVLCLAWPDGHVEYFRGEVEGTVVWPPRGTSGFGYDPIFKPDGYDTTFGE
MSADEKHGWKHGDAFALSHRARAFKKFVETCLEA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagctcgataccagaacgatcgtcgtcgccagccacaacaagggcaagatcgcc
gagatcgccgatctgatcgggcctttcggtttctccgccaaatcggcggcggagctgaac
ttctccgagccggaagagacgggtactaccttcgaggaaaatgccgccatcaaggcgctc
gcgtctgcgaaggcgtccggcctgccggcattgtccgacgattccggcctcgtgattgac
gcgctcgatggtgcacccggtgtctataccgccaattgggcggaaacggccgatggcacg
cgcgatttcgccatggcgatgcagaaggtcgaggatgcgctggccgagcgcggagcctcc
aagccggaagatcgcacggcccgctttgtcagcgtgctgtgcctggcctggccggatggg
catgtcgaatatttccgtggcgaggtcgaaggcaccgtggtgtggccgccgcgcggtacg
agcggtttcggttatgatcccatctttaaacccgatggatatgacaccacattcggcgaa
atgagcgcggatgaaaaacacggctggaaacatggcgacgctttcgcactttctcaccgc
gcccgggcgttcaaaaaattcgtagaaacctgcctggaggcatga

DBGET integrated database retrieval system