KEGG   Agrobacterium fabrum: Atu0503Help
Entry
Atu0503           CDS       T00070                                 

Gene name
fadB
Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
atu  Agrobacterium fabrum
Pathway
atu00071  Fatty acid degradation
atu00280  Valine, leucine and isoleucine degradation
atu00281  Geraniol degradation
atu00310  Lysine degradation
atu00362  Benzoate degradation
atu00380  Tryptophan metabolism
atu00410  beta-Alanine metabolism
atu00640  Propanoate metabolism
atu00650  Butanoate metabolism
atu00903  Limonene and pinene degradation
atu00930  Caprolactam degradation
atu01040  Biosynthesis of unsaturated fatty acids
atu01100  Metabolic pathways
atu01110  Biosynthesis of secondary metabolites
atu01120  Microbial metabolism in diverse environments
atu01130  Biosynthesis of antibiotics
atu01200  Carbon metabolism
atu01212  Fatty acid metabolism
Module
atu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Atu0503 (fadB)
   00650 Butanoate metabolism
    Atu0503 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    Atu0503 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    Atu0503 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Atu0503 (fadB)
   00310 Lysine degradation
    Atu0503 (fadB)
   00380 Tryptophan metabolism
    Atu0503 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Atu0503 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Atu0503 (fadB)
   00281 Geraniol degradation
    Atu0503 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Atu0503 (fadB)
   00930 Caprolactam degradation
    Atu0503 (fadB)
Enzymes [BR:atu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Atu0503 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Atu0503 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Atu0503 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 UDPG_MGDP_dh_N GIDA 2-Hacid_dh_C FAD_binding_3 Pyr_redox_2 NAD_binding_8 ApbA NAD_binding_7 Pyr_redox Sacchrp_dh_NADP NAD_Gly3P_dh_N F420_oxidored Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 1132541
NCBI-ProteinID: NP_353531
UniProt: A9CK81
Position
circular:493225..495441
Genome map
AA seq 738 aa AA seqDB search
MSTYTNFTIETDADGIALVTWDMPEKSMNVFTAEVLEELNAIVDATVADGAVKGVVFTSG
KSSFSGGADLSMLKSMFALYNDEKAKSPDAAAAKLFELVGRMTGLFRKIETNGKPWVSAI
NGTCMGGAFELSLACHGRVASSAKSLKIALPEVKVGIFPGAGGTQRVSRLTDAQSALQMM
TTGQSLTGARAKAMGLVHQVVEPDQLVATAKQMIKDGLKPVAPWDEKGFKAPGGGIWTPA
AAQLWPAAPAILRRESAGNYPAALAILKCVYEGLQLPFDTALKVEQRYFTEILRSKEAFG
MIRSLFISMQELNKGARRPAGQPKTEFKKVGVVGAGFMGAAVAYVTAAAGIPVTLVDRDQ
DAADKGKGHCEESVKAAIGKGRLTQEEGKALLDLVTPTSDYATLADADLVIEAVFEDRDV
KKAVIEAVEAVLPEGAIFASNTSTLPITGLAKNSKRPADFIGIHFFSPVEKMMLTEVILG
KETGDKALAVALDYVAKIRKTPIVVNDTRGFFVNRCVLRYMAESYDMLIEGVPAAMIENA
AKFAGMPVGPLALNDEVAIDLSYKILKATVADLGEKAVDPRHMELVKKLVEGDGRFGRKN
AKGFYDYPPKPAKKSLWPGLKDLYPQQKPEDVDMDVLKQRFLVTVALEAARTVEEGIVTD
PREADVGSILGFGFAPYTGGALSYIDGMGVKNFVALAEKLSEAYGPRFQPTPLLKDMAAK
GETFYGRFDPYASAAKAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttataccaatttcaccatcgagacggacgcagacggcattgccctcgtcacc
tgggacatgccggaaaaatccatgaacgtcttcacggcagaggttcttgaggaactgaac
gccattgtcgatgccaccgttgccgatggcgcggttaagggtgtcgtcttcacttcgggc
aaaagcagcttttccggcggtgccgatctgtcgatgctgaagtccatgttcgccctttat
aatgacgaaaaggcgaaaagccccgacgctgccgcggcgaagctgttcgaactcgtcggt
cgcatgacgggcctgttccgcaagatcgagaccaatggcaagccgtgggtctcggccatc
aacggcacctgcatgggtggcgcatttgagctttcgcttgcctgccatggccgcgtggcc
tccagtgccaagagcctcaagatcgcactgccggaagtcaaggtcggcatcttccccggt
gccggcggtacccaacgcgtatcgcgcctgaccgacgcgcaatcggcgttgcagatgatg
acgacagggcaatccctgaccggcgcgcgcgccaaggccatggggctggtgcaccaggtg
gtcgagccggatcaactggtcgcaaccgcaaagcagatgatcaaggacggcctgaagccg
gtggcaccctgggatgagaagggcttcaaggcccccggcggcggcatctggacgccggcc
gcagcccagctctggcctgccgctcccgccatcctgcgccgcgaaagcgccggcaactac
ccggctgcacttgccatcctgaaatgtgtttatgaaggcctgcaattgcccttcgacacg
gcgttgaaggtggagcagcgttatttcaccgaaatccttcgctcgaaggaagccttcggc
atgatccgctcgctgttcatttccatgcaggaactgaacaagggtgcgcgccgcccggca
ggccagccgaagacggagttcaagaaggtcggcgtcgtcggcgcgggcttcatgggcgct
gccgtggcttacgtcaccgccgcagccggcattcccgtgacgctggtggatcgtgaccag
gacgcggccgacaagggcaagggccattgcgaggagagtgtgaaggccgccatcggcaag
ggcaggctgacgcaggaagagggtaaggccctgctcgacctcgttaccccgacatccgat
tacgccacactcgccgatgccgatctcgtcatcgaagccgtcttcgaggatcgtgacgtg
aagaaggccgtcatcgaggccgtggaagccgtgttgcccgaaggtgcgatctttgcctcc
aacacctccactttgccaatcacgggcctcgcgaagaactcgaagcgcccggcggatttc
atcggcatccatttcttctcgccggtcgagaagatgatgctgacggaagtgatcctcggc
aaggaaaccggtgacaaggcgctggccgtcgcgctggattacgtggcgaagatcaggaaa
acgccgatcgtggtcaacgatacgcgcggtttcttcgtcaatcgctgcgtgctgcgctat
atggcggaaagctacgacatgctgatcgaaggcgtgcccgccgccatgatcgaaaatgcc
gcgaaatttgccggcatgccggtcggtccactggcgctgaatgacgaggtggcgatcgat
ctttcctacaagatcctgaaagccactgtcgccgatctcggcgaaaaggccgtcgatccg
cgtcatatggaactggtgaagaagctggtggaaggcgacggccgctttggccgcaagaac
gccaagggcttttacgactacccgccaaagcccgccaagaaatccctctggcccggcctg
aaggacctctatccgcagcagaagcctgaagacgtggatatggatgtgctgaaacagcgc
ttcctcgtcaccgtggcgctcgaagccgcccgcacggtggaagaaggcatcgtcaccgat
ccgcgtgaggcggatgtcggctccatcctcggtttcggcttcgcgccctataccggcggt
gcgctgtcctacatcgacggcatgggcgtgaagaatttcgtcgctctggccgagaagctc
agcgaagcctatggcccgcgcttccagccgacgccgctcctgaaggacatggcggccaag
ggcgagaccttctacggtcgcttcgacccctatgccagcgccgcgaaggcggcataa

DBGET integrated database retrieval system