KEGG   Agrobacterium fabrum: Atu1257
Entry
Atu1257           CDS       T00070                                 
Name
(GenBank) GGDEF family protein
Organism
atu  Agrobacterium fabrum
SSDB
Motif
Pfam: GGDEF
Other DBs
NCBI-ProteinID: AAK87052
UniProt: Q7CZM8
Position
circular:complement(1244567..1245814)
AA seq 415 aa
MLDAKTSTLLWAAETFTLAVLLGTLWLHRPSRRHNLYFAAGFLATGFGTVMVALRGDISS
FLSIQVGNTLALSAFGFWLAGLLSLEQRKLGGWIAIPALLWIAGMFVPSVPEDMVARILL
YHASAATGYFMLAGVLLGSRARASRSRKVLATILILQAFAGAIVASIVIPANAAVPNAIP
MTSALSISGMLGFTAIIMISAKIIMEDTEIRLHRLAMTDHLTGVLNRRGLLEEFEHIKKR
SHGSDRYVALVLFDIDHFKKINDRYGHQSGDAVLVHFCNIAQRVIGERGLFVRMGGEEFA
LVAEVESPSSTVTLAEAIRSNLRLSKITARNEAIKVTTSVGISEAMIKDADLSVMMTEAD
RALYAAKKAGRNRTVIHVNSANVVVPAPDRDENPMDNNADRQVAALNRISAIASR
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgctggatgcaaagacgagcacgctactgtgggcggcggagacgttcacccttgccgtg
cttttgggaacgctgtggctgcaccgcccttcgcgccggcataatctctatttcgccgcc
ggtttcctcgccacaggcttcggtaccgtcatggtggcgcttcgcggggatatttcgagt
tttctgtccattcaggtcggcaatacgcttgcactttccgccttcggtttctggctcgcg
ggcctgctatctctggagcagcgcaaactcggcggctggatcgccattccggcgctattg
tggatcgccggaatgttcgtgccatcagtgcctgaagacatggtcgctcgcatcctcctt
tatcatgccagcgcggccacgggatatttcatgctcgccggcgtgcttctgggcagcagg
gcacgtgcttcacgcagccgaaaggtgctggccacgatcctgatcctgcaggcctttgcc
ggagcgatcgtcgcctccatcgtcatcccggccaatgccgcggttcccaacgccatcccc
atgacatcggcgctctccatttccggcatgctcggctttacggccatcatcatgatcagc
gccaagatcatcatggaagacacggagatccgcctccaccggctcgccatgaccgatcac
ctgaccggtgtcctcaaccggcgcggtctgctggaggaattcgaacacatcaagaagcgc
tcgcacggctccgaccgctacgtggcgctggttctcttcgacatcgatcatttcaagaag
atcaatgacagatacggacatcagtctggcgatgccgtgcttgtgcatttctgcaatatc
gcacaacgcgtgatcggcgagcgcggccttttcgtccggatgggcggcgaggaatttgcg
ctggtggccgaagtcgagagcccgtccagcaccgtgacactcgcggaggccatccgtagc
aatctgcgcctctcgaagatcaccgcacgcaacgaagccatcaaggtgacgaccagcgtc
ggcatatccgaagcaatgatcaaggatgccgacctgagcgtgatgatgaccgaggccgac
cgcgcactttatgccgccaagaaagcggggcgcaaccggaccgtcatccatgtgaattcg
gccaatgtcgtcgtgcccgccccggaccgggacgaaaacccgatggacaacaatgccgac
cggcaggtcgcggcactgaaccgtatatccgccatcgccagccggtga

DBGET integrated database retrieval system