KEGG   Agrobacterium fabrum: Atu1294
Entry
Atu1294           CDS       T00070                                 

Gene name
dinP
Definition
(GenBank) DNA polymerase IV
  KO
K02346  DNA polymerase IV [EC:2.7.7.7]
Organism
atu  Agrobacterium fabrum
Brite
KEGG Orthology (KO) [BR:atu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:atu03400]
    Atu1294 (dinP)
Enzymes [BR:atu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Atu1294 (dinP)
DNA repair and recombination proteins [BR:atu03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    Atu1294 (dinP)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH DNA_pol_lambd_f Cdd1
Other DBs
NCBI-ProteinID: AAK87087
UniProt: Q8UFV3
Position
circular:complement(1284614..1285831)
AA seq 405 aa
MRRCRACGSPRLLYHSELYDLSIAHIDCDAFYASVEKRDNPELADKPVIVGGGKRGVVST
ACYIARIHGVRSAMPMFKALEACPDAVVIKPDMEKYSRVGREIRTMMQELTPLVQPLSID
EAFLDLSGTEKLHHDPPARVLAKFTGRVEKEVGVSVSAGLSYCKFLAKVASDLQKPRGFS
VVGEAEALSFLAARPVTTIWGVGKAFAATLEADGIRMIAQLQEMEESELMRRYGVMGQRL
FRLARGIDERHVHNNDPVKSVSSETTFFHDISRHEDLVPILRSLSEKVAWRLKKSGIAGQ
TVVLKMKTADFKSRTRNRRLDDPTQLADRIFRTGLALLEKETDGTKFRLIGIGVSDLRDA
GLADPPDLVDRQATRRAAAEAAMDKLRDKFGKGSVETGYTFRTRK
NT seq 1218 nt   +upstreamnt  +downstreamnt
ttgaggcgttgccgcgcctgtggcagcccgcgtcttctctatcattccgaactctacgat
ctgagcatcgcccatatcgattgcgatgccttttatgcctctgtcgaaaagcgcgacaat
ccggaactggccgataaacctgtgatcgttggcggcggcaagcgcggggtggtttccacc
gcctgttatatcgcccgcatccacggcgtgcgctccgccatgcccatgttcaaggcactg
gaagcctgcccggatgcggtcgtcatcaagccggatatggaaaaatacagtcgtgtcggc
cgtgaaatccggaccatgatgcaggaattgacgccgctagtgcagccgctttccatcgac
gaggcgtttctcgatctttcaggtaccgagaagctgcatcacgatccgccggcgcgggtg
ctggcgaagttcaccggacgcgttgaaaaagaggtgggggtgagtgtttcggcagggctt
tcctattgcaagtttctcgccaaggtcgcgtcggacctgcaaaagccacgcggcttttct
gttgtcggcgaagcggaggcgctgtcctttctggcagcgcgcccggtcacgacgatctgg
ggcgtgggaaaggcctttgcagcgacgctggaggcggatggcatccgcatgatcgcgcaa
ttgcaggagatggaggagagcgagctgatgcgccgttacggcgtgatggggcagcggctg
ttccggctcgcacgcggcattgacgagcggcatgtgcataataacgatccggtcaaaagc
gtatcgtccgaaaccaccttcttccacgatatttcccgccatgaggacctcgttccaatc
ctgcggtcactctccgaaaaagttgcctggcggttaaagaaaagcggtattgccggccag
accgtggtgctgaagatgaaaacggcggacttcaagagccgcacccgcaaccgcaggctt
gatgaccccactcagcttgccgaccgcatattccgcaccggccttgccctgctggaaaaa
gaaaccgacggcacgaaattccgcctcatcggcatcggcgtcagcgatctgcgcgatgcc
ggtcttgccgatccgcccgatctcgttgacagacaggccacgcggcgggccgcggcggag
gcggcaatggacaagctgcgcgataagttcggcaagggcagcgtcgagactggctacacc
ttccgcacccgcaaatag

DBGET integrated database retrieval system