KEGG   Agrobacterium fabrum: Atu2053Help
Entry
Atu2053           CDS       T00070                                 

Definition
(RefSeq) FAD dependent oxidoreductase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
atu  Agrobacterium fabrum
Pathway
atu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:atu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Atu2053
Enzymes [BR:atu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Atu2053
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Atu2053
    1.1.1.-  
     Atu2053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD-oxidase_C FAD_binding_4 BBE
Motif
Other DBs
NCBI-GeneID: 1134091
NCBI-ProteinID: NP_355020
UniProt: Q7CXZ7
Position
circular:complement(2013171..2014583)
Genome map
AA seq 470 aa AA seqDB search
MALKDVVAGKRNEEGIASALAVLKQQLGDKLQTGQAFREQHGHTTTYLTLQAPDGVVFAE
SADDVKAVVKACAQYKVPVIPFGTGSSLEGQVNAPNGGICIDFSRMNRIIEVNAEDLDVT
VEPGVTREDLNVYLRDTGLFFPIDPGANASIGGMASTRASGTNAVRYGTMKDNVLAVTAV
VANGEEIRTARRARKSSAGYDLTRLFVGAEGTLGVITSVTLRLQGIPEKITGGVCTFDSI
KAACDAVIMTIQMGVPVARIELLDEVQVRACNAYSGLNYAEKPTLFVEFHGTEETAALQS
QQFAEIAAECGSVDFRWTGDAAERNKLWKARHDAYWASRALAPHLDGLSTDVCVPISRLA
DCVVETQRDIAENGFLAPIVGHAGDGNFHVLILFDGKDAESVAKTEAFVARLNRRAIAMD
GTCTGEHGIGQGKMSFLAEEAGNALDLMRAIKTSLDPDNIFNPGKLFRLV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcactgaaggatgtggtggcgggcaagcggaacgaagagggtatcgcgtctgcgctc
gcggtgctgaagcagcagctgggcgataagctccagacgggccaggcgtttcgcgagcag
catggccataccaccacctacctgaccctgcaggcgcccgacggtgtcgtttttgccgaa
agcgccgatgatgtgaaggccgtggtaaaggcctgcgcgcaatacaaggtgccggtcatt
cccttcggaacgggatcttcgctcgaagggcaggtcaacgcgcccaatggcggaatatgc
atcgatttcagccggatgaatcgcatcattgaggtgaatgccgaagatcttgacgtgacg
gtggagcccggcgtgacgcgcgaggatctgaatgtctatctgcgcgataccggcctgttc
tttccgatcgatcccggcgccaatgcttcgattggcggcatggcctcgacgcgcgcttcc
ggcaccaatgccgtgcgttacggcacgatgaaggacaatgttctggccgtcaccgccgtt
gtcgccaatggtgaggaaatccgcactgcgcggcgcgcccgcaagtcgtccgccggttac
gacctgacgcggcttttcgtgggggccgaaggcacgctcggtgtcatcacctcggtgacg
ctgcggctgcagggcattccggaaaagattaccggcggtgtctgcaccttcgacagtatc
aaggcggcctgcgatgccgtcatcatgacgatccagatgggcgttccggtcgcccgcatc
gaattgcttgacgaggtgcaggtgcgcgcctgcaatgcctattccggtctgaactatgcg
gaaaagccgacactcttcgtggagttccatggcaccgaggagacggcggcgctgcaatcg
cagcagttcgccgagattgcagccgaatgcggcagcgtcgatttccgctggacgggcgat
gcggcggagcgcaacaagctgtggaaggcgcgccacgacgcctattgggcgtcgcgggcg
ctggcaccacatctcgacgggctttccaccgatgtctgcgtgccgatttcacggctggcc
gattgcgtcgtggaaacgcagcgggatattgccgagaacggctttctggcgccgatcgtc
ggccatgcgggtgatgggaacttccatgtgcttattctgtttgatggcaaggacgccgaa
agcgttgcgaaaacagaggcctttgttgcccgtctcaaccgccgcgccattgccatggac
ggcacatgcaccggcgaacatggcattggccagggcaagatgagttttcttgccgaagag
gcaggaaatgcactggatctcatgcgcgccatcaaaacgtcgctcgaccccgataacatc
ttcaatccgggcaaattgtttcggcttgtctga

DBGET integrated database retrieval system