KEGG   Agrobacterium fabrum: Atu2179
Entry
Atu2179           CDS       T00070                                 
Name
(GenBank) GGDEF family protein
Organism
atu  Agrobacterium fabrum
SSDB
Motif
Pfam: GGDEF
Other DBs
NCBI-ProteinID: AAK87925
UniProt: Q7CXP3
Position
circular:complement(2154605..2155744)
AA seq 379 aa
MLGELDLATVILMQKCSYIVGLLSFIYLKMSNRGLPGPVHLAAGFAAMTVGSTLAGYGEW
KILSPALWELGSVLFGIAGYALIWLGLKTLSDGRFVNRKTILFTCLVALLAIGVALQVAG
NNTFRAALFNGCAALAYLGGAGVLFARWRKEPLLSRLALGAITGVSGLISLAVMKSVLFP
GYASINLVTAFFFIIMLNFAISLFVMMLVAERSERKLLVLANTDPLTGVKNRRFFFQTMP
AAPDPADAAMLLDIDHFKSINDRFGHAVGDSVLQEVARRISGSIRGGDVLARYGGEEFII
FLPGAGVDKACMIGERIRDAVAINEVDCGGLRVGVTISIGVATTGDMRCDLQMLAEKADR
ALYRAKTEGRNCVREALAA
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgctgggtgaactcgaccttgcaacagtcatactgatgcaaaaatgttcttacatcgtt
gggctgttgagttttatctacctgaagatgagtaatcgcggtttgcccggccccgttcat
cttgcggcgggtttcgcggcgatgacggtcggctctacgcttgccggttacggcgaatgg
aagatactttcgccggcgctgtgggagcttggcagcgttttgttcggtattgccggatat
gcgctgatctggcttgggctgaagacgttgagcgacggacgctttgtcaatcgcaaaacc
atcttgtttacctgtcttgtcgccctgctggcgattggcgttgcgctgcaggtggccggc
aacaatacgtttcgcgcggcgctttttaatggctgtgcggctctggcctatcttggcggg
gcgggcgtgctttttgcccggtggcggaaagagccgcttctttcccggctggctctcggt
gcgattacaggcgtttccggtctgatatcgctggcggtgatgaaaagcgtgcttttccct
ggttacgccagcatcaatctggtcactgcgtttttcttcattatcatgctcaacttcgcc
atctcgctctttgtgatgatgctggtagcggagcggtccgaacggaaattgctggttctg
gcgaataccgatccactgacgggcgtcaagaaccggcgtttcttcttccagaccatgccc
gcagcccccgatcccgctgatgcggccatgttgcttgacattgaccacttcaagtcgatc
aatgaccgtttcggccacgctgtcggcgacagcgtgctgcaggaagtggcaaggcgcatc
agcggcagcatccgtggcggcgatgtgctggcgcgttacggcggcgaggaattcatcatt
ttcctgccgggtgccggtgtggacaaggcttgcatgatcggcgagcgcattcgcgacgcg
gttgcgataaatgaggtcgattgcggcggtctgcgtgtcggggtgaccatcagcatcggc
gttgccaccacaggcgatatgcgctgcgatctccagatgctcgccgaaaaggcggatcga
gcgctttaccgggcaaagaccgaagggcgcaattgcgttcgcgaggcgctggccgcgtaa

DBGET integrated database retrieval system