KEGG   Agrobacterium fabrum: Atu2644Help
Entry
Atu2644           CDS       T00070                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase hydrophobic membrane anchor
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
atu  Agrobacterium fabrum
Pathway
atu00020  Citrate cycle (TCA cycle)
atu00190  Oxidative phosphorylation
atu00650  Butanoate metabolism
atu01100  Metabolic pathways
atu01110  Biosynthesis of secondary metabolites
atu01120  Microbial metabolism in diverse environments
atu01130  Biosynthesis of antibiotics
atu01200  Carbon metabolism
Module
atu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
atu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
atu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Atu2644 (sdhD)
   00650 Butanoate metabolism
    Atu2644 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Atu2644 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-GeneID: 1134682
NCBI-ProteinID: NP_355581
UniProt: A9CHJ7
Position
circular:complement(2630584..2630964)
Genome map
AA seq 126 aa AA seqDB search
MDMRTPLGKVRGLGSAKEGTDHFLRQRVTAVANVPLLIFFVIFLIKYAGAPYPEVVAALS
NPLVAVIMALVLVSGLIHMKLGMQVIIEDYVHAEVSKLVLLMLNTFFAILIGGLSIFAIL
KIAFAG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggatatgcgtacacctctcggaaaggttcgcggtctgggctccgccaaggaaggcacc
gaccatttcctgcgccagcgcgtcaccgcggtcgccaacgttccgctgctgatcttcttc
gtgatcttcctcatcaaatatgccggtgcgccttatccggaagtcgtcgccgcgctgtcg
aacccgctcgttgcggtcatcatggctctggtgctggtgtccggcctcatccacatgaag
ctcggcatgcaggtcatcatcgaagactacgttcacgccgaggtttcgaagctcgttctt
ctgatgctcaatacgtttttcgcgattctgattggcggtctttccatcttcgccattctg
aaaatcgcattcgcaggataa

DBGET integrated database retrieval system