KEGG   Agrobacterium fabrum: Atu2719Help
Entry
Atu2719           CDS       T00070                                 

Definition
(RefSeq) aldose epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
atu  Agrobacterium fabrum
Pathway
atu00010  Glycolysis / Gluconeogenesis
atu00052  Galactose metabolism
atu01100  Metabolic pathways
atu01110  Biosynthesis of secondary metabolites
atu01120  Microbial metabolism in diverse environments
atu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Atu2719
   00052 Galactose metabolism
    Atu2719
Enzymes [BR:atu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Atu2719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 1134757
NCBI-ProteinID: NP_355652
UniProt: A9CHG5
Position
circular:2704613..2705632
Genome map
AA seq 339 aa AA seqDB search
MSDGAAREDFGFTATGEKVERVTISKDGLTAKVITWGAVIQDLRLDGHQAPLVLGFDKFE
DYKYSSYFGATPGRNANRIGNGRFAIDGHEYQLELNEKGVTHLHGGSDGMGKRNWMLMEH
GESHAVLQIIDPDGRAGYPGNCTVTATYTIRDGGVLSVVYETVTDQPTIANVCQHSYFNL
DGADTALGHEISIAADFYLPTNEQQIPTGEIRSVEGTVFDLRHPTPMRRKENGEQVLYDH
NFCLSPERRAKRKVARAYSPASDIALEVHTTEPGVQFYSAFKLDVPVPGLDGRHYGPFAG
FCLETQIWPDAVNHPDFPHAILRPGETLRQETDYIFRKG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacggtgcggcacgagaagattttggtttcacggcgaccggcgaaaaggtcgaa
cgcgtcaccatctcgaaagacggtttgacggcgaaagtcatcacctggggcgctgttatc
caggatctgcggcttgacggccaccaggccccgttggtgcttggcttcgacaaattcgag
gattacaaatactcctcctatttcggcgccacgcccggccgcaatgccaaccgtatcggc
aacggcaggttcgcgatcgacggccatgaataccagctagaactgaacgaaaagggcgtg
acccatctgcacggcggcagcgacggcatgggcaagcgcaactggatgctgatggagcat
ggcgaaagccacgccgtcctgcagattatcgaccccgatggacgcgccggttatcccggc
aattgcacggtcactgctacctatacgatccgcgatggcggcgtgctttcggttgtttat
gaaacggtgaccgaccagccgaccatcgccaatgtgtgccagcactcctatttcaacctc
gacggcgcggataccgcacttggccatgagatcagcatcgccgctgacttttacctgccg
accaacgaacagcagataccgaccggcgaaatccgctccgtcgaaggcaccgtcttcgac
ctgcgccacccgacgccgatgcggcgcaaggagaatggcgaacaggttctctacgaccac
aatttctgcctttcgcccgagcgtcgcgccaagcgcaaggtcgcccgcgcctattcacct
gcctccgatatcgcccttgaagtccacacgacagagcccggtgtgcagttctattcagcc
ttcaagctcgacgttcccgttccgggcctcgatggccgccattatggccccttcgccggt
ttctgccttgaaacgcagatttggcccgatgccgtcaatcacccggattttccgcacgcc
atcctgcggccgggcgaaacgctgcgtcaggaaacggattatattttcaggaagggctga

DBGET integrated database retrieval system