KEGG   Agrobacterium fabrum: Atu2769Help
Entry
Atu2769           CDS       T00070                                 

Gene name
phbA
Definition
(RefSeq) acetyl-CoA acetyltransferase; poly-beta-hydroxybutyrate biosynthesis
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
atu  Agrobacterium fabrum
Pathway
atu00071  Fatty acid degradation
atu00072  Synthesis and degradation of ketone bodies
atu00280  Valine, leucine and isoleucine degradation
atu00310  Lysine degradation
atu00362  Benzoate degradation
atu00380  Tryptophan metabolism
atu00620  Pyruvate metabolism
atu00630  Glyoxylate and dicarboxylate metabolism
atu00640  Propanoate metabolism
atu00650  Butanoate metabolism
atu00900  Terpenoid backbone biosynthesis
atu01100  Metabolic pathways
atu01110  Biosynthesis of secondary metabolites
atu01120  Microbial metabolism in diverse environments
atu01130  Biosynthesis of antibiotics
atu01200  Carbon metabolism
atu01212  Fatty acid metabolism
atu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:atu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Atu2769 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    Atu2769 (phbA)
   00640 Propanoate metabolism
    Atu2769 (phbA)
   00650 Butanoate metabolism
    Atu2769 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Atu2769 (phbA)
   00072 Synthesis and degradation of ketone bodies
    Atu2769 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Atu2769 (phbA)
   00310 Lysine degradation
    Atu2769 (phbA)
   00380 Tryptophan metabolism
    Atu2769 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Atu2769 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Atu2769 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Atu2769 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:atu04147]
    Atu2769 (phbA)
Enzymes [BR:atu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Atu2769 (phbA)
Exosome [BR:atu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Atu2769 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 1134807
NCBI-ProteinID: NP_355699
UniProt: A9CHD3
Position
circular:2773879..2775060
Genome map
AA seq 393 aa AA seqDB search
MTLPSIVIASAARTAVGSFNGHFANTPAHELGATVISAVLERAGVAANEVDEVILGQVLM
AGEGQNPARQAAMKAGIPQEATAFGINQLCGSGLRAVALGMQQIVTGDAAIIIAGGQESM
SMAPHCAHLRGGVKMGDFKMIDTMMKDGLTDAFYGYPMGITAENIARQWQLSRDEQDQFA
VASQNKAEAAQNAGRFTDEIVAFTVKGRKADIVIDADEHIRHGASLETMAKLRPAFDKEG
TVTAGNASGLNDGAAATLLMSEQQAAKRGIKPLARIASWATAGVDPQIMGTGPIPASRKA
LAKAGWSINDIGLVEANEAFAAQSCAVVRELGLNPDIVNVNGGAIAIGHPIGASGARVLN
TLIFEMRRRNVSRGLATLCIGGGMGVAMCIEAL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgccttcaatcgtgattgccagcgccgcgcgcaccgccgtcggctctttcaac
ggccacttcgccaacacgcccgcccacgaacttggtgccaccgtcattagtgcggtgctg
gaacgtgccggcgtcgcggccaatgaagtggatgaggtcattctcggccaggtgctcatg
gcaggcgaggggcaaaacccggcgcggcaggcagcaatgaaggccggcattccgcaggag
gcaaccgccttcggcatcaatcagctctgcggctctggcttgcgcgccgtggcgctgggc
atgcagcagatcgtgacgggggatgcggccatcatcattgccggcggccaggaatccatg
tccatggcgccgcattgcgcccatctacggggcggcgtgaagatgggcgacttcaagatg
atagacacgatgatgaaggacggtctgaccgacgccttttacggatacccgatgggcatc
actgccgaaaacatcgctcgccaatggcagctttcccgcgatgagcaggaccagttcgca
gtcgcatcgcagaacaaggccgaagccgcgcagaacgccggtcgcttcactgacgagatc
gtggctttcacggtaaagggccgcaaggccgatatcgtcatcgatgcggacgaacatatc
cgtcatggcgcatcgctcgaaaccatggccaagctgcgtcccgccttcgacaaggaaggc
acggtcacggccggtaacgcctccggcctgaatgacggcgcagccgccacgcttctcatg
tcggaacagcaagcggcaaagcgcggcatcaaaccgctagcgcgcatagcctcctgggca
acggccggcgttgatccgcagatcatgggcaccggtcccatccccgcctcccgcaaggcg
ctggccaaggccggctggtcgatcaacgatattggccttgtcgaggccaacgaggccttt
gccgcccaatcctgcgcggtcgtgcgcgagctgggccttaaccctgacatcgtcaacgtt
aatggcggagcgattgccatcggccatccgatcggcgcttccggcgctcgcgtcctgaac
acgctgattttcgaaatgcgtcgccgcaacgtatcgaggggtctcgcaacgctctgcatc
ggcggcggcatgggtgtcgccatgtgcatcgaggcgctctaa

DBGET integrated database retrieval system