KEGG   Agrobacterium fabrum: Atu2798Help
Entry
Atu2798           CDS       T00070                                 

Gene name
cobL
Definition
(RefSeq) precorrin-6y methyltransferase
  KO
K00595  precorrin-6Y C5,15-methyltransferase (decarboxylating) [EC:2.1.1.132]
Organism
atu  Agrobacterium fabrum
Pathway
atu00860  Porphyrin and chlorophyll metabolism
atu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Atu2798 (cobL)
Enzymes [BR:atu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.132  precorrin-6B C5,15-methyltransferase (decarboxylating)
     Atu2798 (cobL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase PCMT Cons_hypoth95 Methyltransf_4 Methyltransf_25 Methyltransf_18
Motif
Other DBs
NCBI-GeneID: 1134836
NCBI-ProteinID: NP_355726
UniProt: Q7CW86
Position
circular:complement(2799463..2800722)
Genome map
AA seq 419 aa AA seqDB search
MTSEYSGTAKASTEKNEKPWLSIVGIGEDGLQGLGENARQAIEAAEVVFGGKRHLELAAG
AIRGEARAWPVPFDVDMNDVLALRGRLVCVLASGDPFFYGAGVTLLRRIPAEETACYPSP
SAFSLAASRLGWALQSAECVSLHGRSIDLLRPHLHHGARIIALTSDERDPALIARLLSDA
GFGRSEFILLEALGGDREKRRQIRAADFGFEDTDPLNVVAIEVVADEGARLLPFAHGLDD
GLFEHDGQITKREIRAVTLSSLASRRGELLWDIGAGSGSIGIEWMLSHPSLRAIAIEQHP
ERAERIARNADAFGVPGLEVMIGTAPAAFEGLSSPDAIFIGGGGSETGVLEAAMDALKPG
GRLVANAVTLEMEAVLLAAHAKFGGSMIRLEVSRAAAVGSMSGWRPAMPVTQWSWVKPW
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgacatctgaatattccggaacggcaaaggcttccactgaaaagaacgaaaagccgtgg
ctgtccattgtcggtataggcgaggacgggcttcaggggctgggtgaaaatgcgcgtcag
gcgatagaggcagccgaggtggttttcggcggcaaacgccatctggaactggcggctggg
gccattcgcggcgaagcgcgggcctggccggtgccgtttgatgtggacatgaacgatgtt
ctcgcattgcgcggccgcctggtgtgtgtgctggcatcgggcgatccgttcttctatggt
gcgggggtcacgcttctgcggcggattccggcggaggaaacggcttgttatccctcgcct
tccgccttttcgctggccgcctcgcggcttggctgggccctgcaatcggccgaatgcgtt
tcgctgcatgggcgctcaatcgatctgttgcggccacatctgcatcatggcgcgcggatc
atcgcgctgacgtctgatgagcgcgacccagccttgattgcgcggctgctgtccgatgcc
ggcttcggccgttcggaattcatcctgcttgaagcattgggcggagaccgggaaaagcga
cggcaaatccgggctgctgattttggctttgaagatactgatccgctcaatgtcgtcgcg
atcgaggtcgtggcggatgagggtgcgcgcctcctgccttttgctcacgggcttgatgac
ggcctgtttgaacatgacgggcagatcaccaagcgcgaaatccgcgcggtgacgctttcg
tcactcgcctcccgtcggggagaactgctgtgggatattggtgcgggctccggctcgatc
ggcatcgaatggatgttgtcgcatccttcgctgcgcgccatcgccatcgagcagcatccg
gaaagggctgagcggattgcccgcaatgctgacgcttttggtgttccggggcttgaggtc
atgatcggcacggctccggcggcttttgaaggcttgtcttcaccggatgcgatctttatt
ggcggcggcggcagtgagacgggtgtgctggaggccgccatggatgctctgaaaccgggc
gggcggctggtggccaatgcggtgacgctggaaatggaagcggtattgcttgctgcccat
gcgaaattcggcgggtcgatgatccggctggaggtctcgcgggctgctgctgtcggttcc
atgtccggctggcgtccggctatgccggtgacacaatggagctgggtcaagccatggtga

DBGET integrated database retrieval system