KEGG   Agrobacterium fabrum: Atu2811Help
Entry
Atu2811           CDS       T00070                                 

Definition
(RefSeq) hypothetical protein
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
atu  Agrobacterium fabrum
Pathway
atu00051  Fructose and mannose metabolism
atu01100  Metabolic pathways
atu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:atu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Atu2811
Enzymes [BR:atu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     Atu2811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-GeneID: 1134849
NCBI-ProteinID: NP_355739
UniProt: Q7CW73
Position
circular:complement(2814376..2815578)
Genome map
AA seq 400 aa AA seqDB search
MNPDPDYSAAYVILDTDEPRLKGHGLTFTIGRGNDICCMAIEAMRHLVVGTDLATVTENP
GKYWRHLTSDSQLRWIGPDKGAMHLATGAVVNAVWDLLAKKAGKPVWQLVADMSPEEIAD
IVDYRYLTDVLTRDDALAILRRAEAGKKERIETLKNEGYACYTTSAGWLGYDDAKLRRLC
QEAIDAGFNHVKMKVGRDLEDDIRRLTITREVIGPDRYLMIDANQVWEVDQAIEWVNKLA
FSKPFFIEEPTSPDDIAGHRKIRAAIGSVKVATGEMCQNRIMFKQFIAEGAIDVVQIDSC
RMGGLNEVLAVLLIAAKYNLPVWPHAGGVGLCEYVQHLSMIDYLVVSGTKEGRVIEYVDH
LHEHFIEPCDIRNAAYMPPKLPGFSIEMKPESIETYTFEE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgacccggattattcggcggcttacgtcattctggatacggatgagccgcgc
ctgaagggccatggcctgaccttcaccatcggccgtggcaatgacatttgctgcatggcc
atcgaagcgatgcgccatctggtcgtcggcaccgatcttgctactgtcactgaaaacccc
ggcaaatattggcggcatctaaccagcgatagccagctgcgctggatcggcccggataag
ggcgcgatgcatctcgctaccggcgcagtggtcaacgcggtgtgggatttgctggccaag
aaggccggcaagccggtctggcagcttgttgccgatatgagcccggaagagatcgccgat
atcgttgattatcggtacctcaccgacgtgctgacccgcgatgatgcgctggcgatcctc
agaagggccgaagcgggcaagaaggaacgcatcgagacactgaagaacgagggttatgcc
tgctatacgacgtcggccggctggctgggttacgacgatgccaagcttcgccgtctctgc
caggaggcaatcgatgccggtttcaaccatgtgaagatgaaggtcggccgcgatctggag
gacgacatccgtcgtctcaccattacccgtgaagtgattggccctgatcgttacctgatg
atcgacgccaaccaggtatgggaagtggatcaggcgatcgagtgggtgaataagctcgcc
ttttccaagcccttcttcatcgaagagccgaccagcccggatgatatcgccggccatcgc
aagattcgcgccgccatcggctcggtgaaggtggcaaccggagaaatgtgccagaaccgc
atcatgttcaagcagttcatcgccgaaggcgcgattgatgtcgtgcagatcgacagctgc
cgcatgggtggcctgaacgaggtactggcggttctgctgattgctgccaaatacaatctg
ccggtctggccgcatgcgggtggtgtcggcctttgcgaatatgtgcagcacctgtcgatg
atcgactatctcgtggtgtcaggcaccaaggaaggccgcgtgatcgaatatgtcgaccat
ctgcatgagcacttcatcgagccctgcgatatccgcaacgccgcttatatgccgccgaag
ctgccgggcttctccatcgaaatgaagccggagtcgatcgagacttacactttcgaggag
tga

DBGET integrated database retrieval system