KEGG   Agrobacterium fabrum: Atu3223Help
Entry
Atu3223           CDS       T00070                                 

Definition
(RefSeq) ribose ABC transporter ATPase
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
atu  Agrobacterium fabrum
Pathway
atu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:atu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Atu3223
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:atu02000]
    Atu3223
Enzymes [BR:atu01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     Atu3223
Transporters [BR:atu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    Atu3223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 RsgA_GTPase AAA_30 AAA_23 Arc_PepC MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 1135097
NCBI-ProteinID: NP_357381
UniProt: A9CEV9
Position
linear:236874..238397
Genome map
AA seq 507 aa AA seqDB search
MSETAPLLEARAIGKSFLGITALDGVDFSLARGEIHALLGENGAGKSTLIKILTGVYHRD
SGSIFLDGSEISPANVGEAQALGIGTVYQEVNLLENLTVAENLFLGRQPHRFGMIDRASM
QKQSQALLTQYGLSIDVNALLSSYSVAIRQIIAIARAVDLSGKVLVLDEPTASLDAHEVE
MLFGVLKNLRARGIGIIIITHFLNQVYDIADRVTVLRNGRLVGTRDIGSLPRSELIAMML
GRELQHITHEHQAADDTVVDGEPPIHFEGYGKRGSIAPFDLGIRPGEIVGVAGLLGSGRT
ETAFLLFGVDKPDTGKATIDGKTVAISSPEAAITAGFGFCPEERKTDGIIGDFSVTDNIA
LALQARQGWARPLSRRQKAELAESFIKSLDIRPADPNRPIKFLSGGNQQKAILARWLATH
PRLLILDEPTRGIDIGAHAEILKMIEKLCTEGMSLVVISSELEELTAVAHRVVVLSDRRH
VSELKGGDVTADNIMRAIAEAAKTEAA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaactgcaccacttctggaagcacgcgccatcggtaaatcctttctggggatc
acggcgctggacggcgttgatttttcgcttgcacgcggtgaaatccatgcgcttctcggc
gaaaacggcgcgggcaagtcgacgctcatcaaaatcctgaccggcgtttaccaccgcgac
agcggctcgatctttctcgacggaagcgagatatcgcccgccaatgtcggcgaggcacag
gcgctcggtatcggcaccgtttatcaggaagtaaaccttctcgaaaatctcacggttgcg
gaaaacctatttctcggccgccagccgcatcgcttcggcatgatcgaccgggcctcgatg
cagaagcagtcccaggcgctgctaacacaatacgggctttccatcgacgtcaacgccctg
ctgtccagctattccgtcgccatccgccagatcatcgccattgcccgcgctgtcgatctt
tccggcaaggtgctggtgctggacgagccgaccgccagtctcgacgcccatgaggtcgag
atgttgttcggcgtgctgaaaaacctgcgcgcgcgcggcatcggtatcatcatcatcacc
catttcctcaatcaggtctatgatatcgccgaccgcgtgacggttctgcgcaatggtcgt
ctcgtcggcacgcgcgatatcggcagcctgcccagatccgaactcatcgcgatgatgctg
ggccgcgaattgcagcacatcacccacgaacatcaggcggcggatgatacggtcgttgat
ggcgaaccgcctatccatttcgaaggttacggcaaacgcggcagcatcgcccctttcgac
cttggcattcgtcccggcgaaatcgtcggcgtcgccggtcttctcggctccggccgcacc
gaaacggctttcctgctgttcggcgtcgacaagcccgataccggcaaggccacgatagac
ggaaagacggtggcgatttcctcacccgaagccgccatcaccgccggcttcggcttctgt
ccggaagagcgcaagacggacggcatcatcggcgatttttcggtgaccgacaatattgcg
ctggcacttcaggcccgtcagggctgggcacggccattgtcccgtcggcaaaaagcggag
cttgccgaaagcttcatcaaatcgctcgatatccgtcccgccgatcccaaccggccgata
aaattcctgtccggcggcaaccagcagaaagccattctggcacgctggctcgccacccat
ccccggcttctgattctcgatgaaccaacccgcggcatcgatatcggcgcccatgcagaa
attctcaaaatgatcgaaaaactctgtaccgagggcatgtcgcttgtggtcatctcgtcc
gaactcgaagagctgaccgccgttgcccatcgcgtcgtcgtgctctccgaccgccgccac
gtcagcgaattgaagggtggtgacgtcaccgccgataacatcatgcgggcgatcgccgag
gcggcgaaaacggaggcggcatga

DBGET integrated database retrieval system