KEGG   Agrobacterium fabrum: Atu3640
Entry
Atu3640           CDS       T00070                                 

Name
(GenBank) conserved hypothetical protein
Organism
atu  Agrobacterium fabrum
SSDB
Motif
Pfam: Ntox15 Tox-PAAR-like GDE_C
Other DBs
NCBI-ProteinID: AAK89757
UniProt: A9CFH2
Position
linear:complement(692241..693821)
AA seq 526 aa
MSIPRDNYIGEPQYPDTWTTKTPREGLRDIDEARIVSLAPDVCLTPVGSSVVPIPYPVVD
FCGHDKNYTPSVRFTGKKAMVMRSCTTHVHGDAPGVRKGVKSGTVESVCEPIGHADQVRA
EGSHVIRHLDRFHMNSKNTEGEAIFVRSTQTYNSPKDDDPVRGSLRAIEVADASEEQNRS
SDAAPSGGAALGFLVTPGFAPLVQGAGGAAAGGASTAAGAATSGAGGAAAAAGGVSLGTI
LAGIGIFAAGVLIPTNKMNFSDTVPQDDFEQKLLLDAQRRMNELPFWDSGADIRTETFAK
IQEHRKKNKPTQDPEPTPVPVPPPGSNVRIDEDENRRCRLLIICFMPTKSTIDIDEFKRQ
MELQEQGLNNMSPQQMLANQAKYLANPAGMRALSEPLQAKARQEYRNDPRIQKKYVDQYG
PIQGPIKLGEYLDSAAALHNPDMIAGGKYNSVVDQTLPIENRIGGLSENSSMGSQWINPN
RNGHTRASRLTEHAKRQAANNCPSVQVDLRLCPSNPSRPGEPLTGT
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgagtatccctcgcgacaactatatcggtgaaccacaataccccgatacatggacgacg
aagacgccacgcgaggggttacgtgacattgatgaggcgcgtatcgtctctttggcacct
gatgtatgcctgacaccggtcggctcgtcggtggtgcctattccctatcctgtcgtggat
ttttgtggccacgataaaaattacacgccttccgttcggtttacgggtaagaaggcgatg
gtcatgcgttcgtgcacaacacatgtccatggcgatgcacccggtgtccgaaaaggtgtg
aaatctggaacggtggagagcgtatgcgaaccgatcggccatgccgaccaggtgcgtgca
gagggttcgcacgtcatccgccacctcgaccgttttcatatgaacagcaagaataccgag
ggtgaggcgatctttgtccgcagcacgcagacatataactctcccaaggacgatgatccg
gtgcgaggatcgcttcgtgcaattgaagtcgccgatgcttcagaagagcaaaaccgttca
tctgacgctgctccttccggtggcgctgctctaggttttctcgtcacgccaggatttgct
ccactcgttcaaggtgcgggtggagccgcggctggaggagcaagtaccgctgccggtgca
gcaacttccggtgctggaggggctgccgccgccgcgggaggtgtcagtttgggaacgata
ttggcggggatcggaatattcgccgccggtgtgcttattccgaccaacaaaatgaatttt
tccgataccgtcccacaggatgattttgaacagaaattgcttttagatgcgcaacgcaga
atgaacgaacttccattctgggacagtggtgctgacatccgaactgagacgtttgcaaaa
attcaggagcacagaaagaaaaataaacctacgcaggacccggagcctacgcctgtccct
gtgccgccacctggatcaaatgttcgtatagacgaagatgagaaccgtagatgtcggtta
ttgataatatgctttatgcccaccaaaagtacgatcgatattgatgagttcaagcgacaa
atggaattgcaggaacaagggctcaacaatatgagtccacagcagatgctggccaatcaa
gcaaaatatctagcaaatccggcgggcatgcgggctttgtcggagccactgcaggcgaaa
gcgcgccaagaatatagaaacgacccgcgtatccagaaaaagtacgttgatcagtacggt
ccaatccagggtccgataaaattgggagaatatctggattcggcggcggcattgcataat
ccagacatgatcgcgggtgggaaatataattctgtggtcgatcagaccttgccaattgaa
aatcggataggtggcctttccgagaatagttctatgggaagtcaatggatcaatccaaat
cgaaacggacatactcgcgccagccgactaacagagcatgctaagagacaagcggcgaac
aactgccccagtgtgcaagtcgatcttcgactttgccccagcaaccccagtcgccccggt
gagccattaacaggaacatga

DBGET integrated database retrieval system