KEGG   Agrobacterium fabrum: Atu3641
Entry
Atu3641           CDS       T00070                                 

Name
(GenBank) conserved hypothetical protein
Organism
atu  Agrobacterium fabrum
SSDB
Motif
Pfam: DUF2169 DUF1654
Other DBs
NCBI-ProteinID: AAK89756
UniProt: A9CFH3
Position
linear:complement(693818..694927)
AA seq 369 aa
MELQNRLPFPAMAFRQFDAEGGRDCIVSVRATFTHVQDGTMEIAREQESFQWEDAYEGDP
HQTVLLRQSDLTPDKPGTDISFLGDAWSPSQEPQKSWRASIRVGDVSKEIDVCGQRFWKP
VIKEKWAGFYAREPKRVISDWVLNDPEPARQVAVCWTNAFGGTIPGTGDTETDTPADVER
RNLLGCGIVNLDMPADTPPVRAPQITSPGERLDWKDAPEPQGFGLVSPWWRSRQQYTGTY
DDAWVAERHPLLPRDFDPRFWQAAHPDLVATPHLKGDEKYELVNLSSEHPVAKGSLPGLT
LGVHCSREDRDEWHVLKLDGVQFDWRDDGRVLLTWRVSFPLPDAGETTLTLTRVRLKAPE
TEAAARETA
NT seq 1110 nt   +upstreamnt  +downstreamnt
ttggaacttcagaaccgcctgccgtttcccgcgatggctttccgtcagttcgatgccgaa
ggagggcgcgattgtatcgtctccgtgcgcgctaccttcacgcatgtgcaggacggaaca
atggagatcgctcgtgagcaggagagctttcaatgggaagacgcttacgagggtgatccg
catcaaacagtcctcctgcggcagagcgatctgacccctgacaagcccggcacggatatc
agcttcctgggagatgcatggtcaccgtcgcaggagccacagaaatcctggcgcgcctcc
attcgtgtcggtgatgtttccaaggagatcgatgtatgcggtcaacgattctggaaaccc
gtcatcaaggaaaagtgggcagggttctacgcaagggagccgaagcgggtcatcagcgat
tgggtgctgaacgatcccgagccggcccgtcaggtcgctgtctgctggacgaatgccttt
ggcggcaccattccaggcacaggtgataccgaaaccgacacccctgcggatgtggagcgt
cgcaatcttctggggtgcggtatcgttaatctcgacatgcccgcagacacgcctcccgta
cgcgcgcctcagatcacgtcgcccggcgaacgactggactggaaggacgcgccggagcca
cagggatttggcctggtatcgccttggtggcgttcccgtcagcaatataccggaacctat
gacgatgcatgggttgcggaacggcatccgcttttgcctcgtgatttcgatccacgcttc
tggcaggccgcccatcctgatctcgtcgcgacgcctcacctcaagggtgacgagaaatac
gagctcgttaacctgagttctgagcatccggtcgcgaaaggctcgctgcccggcctcacc
ctcggtgtccattgctctcgcgaggatcgcgacgaatggcatgtgctgaaactagatggc
gtgcaattcgactggcgcgatgacggacgagtgcttctgacctggcgcgtcagctttccg
cttcccgatgctggtgaaacaacgcttaccctgaccagggttcgcttgaaggctcctgaa
accgaagcggctgcaagggagacagcatga

DBGET integrated database retrieval system