KEGG   Agrobacterium fabrum: Atu3819Help
Entry
Atu3819           CDS       T00070                                 

Gene name
rbsC
Definition
(RefSeq) ribose ABC transporter permease
  KO
K10440  ribose transport system permease protein
Organism
atu  Agrobacterium fabrum
Pathway
atu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:atu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Atu3819 (rbsC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:atu02000]
    Atu3819 (rbsC)
Transporters [BR:atu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Atu3819 (rbsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-GeneID: 1135693
NCBI-ProteinID: NP_356803
UniProt: A9CFQ2
Position
linear:915811..916809
Genome map
AA seq 332 aa AA seqDB search
MSDITAITEKHNVAPRFHRGGRLAGLFAKGGLLLAILLVILYGSFSSPVFFTTGNFINIL
TSMAIVGIVVVGMTFVLVTGGLADLSVPATIACGAILSLALQPEIGAVPAFVVAIALAGA
CGLINGLLIGYIGVNPIIATLGLGTIILGIVQAAVGGVIVYGTDPAIATFVKSRILGIPL
VVLVFLAVAVAGHFVLSSTIWGRWTLATGGNYRAARASTVPVRAVKAGAFVITGLASGLS
GGLLGLTLQSARPLVGTGYEFSAITAVVVGGISIMGGFGSVPRAIAGLGLVQLLTNVMVL
QGVPTPIQGFVLGLLIAFAVALDVALRRRAVA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacatcaccgctatcaccgaaaagcacaatgtcgccccgcgctttcatcgcggc
gggcggctggcgggcctgttcgccaaaggcggcctgctgctggccattcttctcgtgatc
ctatacggctcgttttcaagcccggtcttcttcacgacaggcaatttcatcaatatcctg
acatccatggccattgtcggcatcgtggtcgtgggcatgaccttcgtcctcgttaccggc
gggctcgccgacctgtcggtgccggcaaccatcgcctgcggcgcgatcctgtctctggcg
ttgcagccggagatcggcgcagttccggcctttgtggtcgctatcgcactcgccggcgcc
tgcggtctcatcaacggattgctgatcggttatatcggcgtcaatccgatcatcgcgacc
cttggcctcggcaccatcattctcggcatcgtgcaggcggcggtcggcggcgtcatcgtt
tatggaaccgatccggccatcgccaccttcgtcaaaagccgcattctcggcattccgctt
gtcgtgctggtgtttctcgccgtcgcggtggcaggccatttcgtcctgtcgagcaccatc
tggggccgatggacactcgccaccggcggcaattaccgggcggcgcgggccagcaccgtg
ccggtccgggcggtcaaggccggtgcattcgtcatcaccgggctggcatccggcctcagc
ggtggcctgctcggcctcaccctgcaaagcgcacgtccactggtcggaacgggttatgaa
ttcagcgccatcaccgccgtcgtggttggtggcatctcgatcatgggcggcttcggctcg
gtgccgcgcgccatcgccggcctcggcctcgtccagctcttgaccaatgttatggtgcta
cagggcgttcccaccccgatccagggtttcgtcctcgggctgctcatcgcctttgcggtc
gccctcgacgtcgcgcttcgccggagggccgtggcatga

DBGET integrated database retrieval system