KEGG   Agrobacterium fabrum: Atu4331
Entry
Atu4331           CDS       T00070                                 
Symbol
impM
Name
(GenBank) serine/threonine phosphoprotein phosphatase
  KO
K11890  type VI secretion system protein ImpM
Organism
atu  Agrobacterium fabrum
Brite
KEGG Orthology (KO) [BR:atu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:atu02044]
    Atu4331 (impM)
Secretion system [BR:atu02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Atu4331 (impM)
SSDB
Motif
Pfam: TagF_N PP2C PP2C_2
Other DBs
NCBI-ProteinID: AAK89109
UniProt: Q7CUN2
Position
linear:complement(1459258..1460673)
AA seq 471 aa
MADQASRSTQTAAESDRIGFFGKVPSHGDFISDGLERELIATFDDWMRSGMHACADMFAG
RWTEIFSSSPPIRFIVESGIWGNCAYAGVLVPSADRVGRKYPLAIIAQLNGFRRHPRTLY
LDDTWFMAVEALAETSMTGDFDVSRFNASIKKLRLPKPRDEDDAPEMVRGRAPTSLWWHI
DPVSRRARGLKFDGKPRASDFLRLFSDMTGKGDEDGSRAAPAPATVQEKTKQQIPPVTPA
PAHPAEQPSSVIYSYATHPGTRLSLNADALFVSQTPSLFAIADGQGDTHSAAEAARLATN
ILAETPDAENPEMMAQQIRGKLGTVNSLLLSRQATGADGRPMASVVIASIIAHRLSVLWS
GDARAYLLKNGTMHQLSRDHVVVGMKKQLSQCVGLSQQFRPDIVFDEWGLQDRLLLCSYP
LVQILRERAIAEIVFNTPIKDCANALVQEALIENARENVSAIVIGNRREQG
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggccgatcaggcatcaaggtccacgcaaacagcggcggaaagcgatcgcatcggtttc
ttcggcaaggtccccagccatggcgatttcatttccgatgggctcgagcgggaattgatc
gctaccttcgacgactggatgcgatccggcatgcacgcctgcgcggatatgttcgcaggc
cgatggacagagatattctcgtcgtcgccgcccatacgcttcatcgtcgaaagcggcata
tggggaaactgcgcctatgccggcgtgctggtgccgagcgccgaccgggtgggccgtaaa
tatccgcttgccatcattgcccagctcaacggcttccgcagacatccgcgaacactctat
ctcgacgacacctggttcatggccgtagaggcattggccgagacatcgatgaccggcgat
ttcgacgtgtcccggtttaatgcctcgatcaagaaattgcgcctaccgaagccgcgggac
gaggatgacgcgccggaaatggtccgcggccgcgcgccgacaagcctctggtggcacatc
gatcccgtcagccgccgtgcacgcggcctcaaattcgacggcaagccgagagcatccgat
tttctgcgcctcttcagcgacatgacaggcaaaggcgacgaggacggttcaagagcagcg
ccggcgccggcaacggtgcaggagaagacaaaacagcaaataccgcccgtgacacccgcg
ccagcccacccagcggaacagccgtcatctgtcatctacagctatgccacacatccggga
acgcggctttccctgaatgcggatgcactgttcgtttcccagacgccttccctcttcgcc
atagcggatggacaaggcgatacgcatagcgccgcagaggccgcgcgcctcgccacgaat
attcttgctgaaacgccagatgccgaaaacccggagatgatggcacagcagatcagggga
aagctcggcaccgtcaacagcctgctcctctcccgtcaggcgactggtgccgatggcagg
ccgatggccagcgtcgtcatagcctcgatcatcgcccacaggctgagcgtcctgtggtcc
ggtgatgcgcgcgcctatctcctgaaaaacggcaccatgcaccagctttcgcgcgatcac
gtcgttgtcggcatgaaaaaacagctctcgcaatgtgtcgggctttcccagcaattccgg
ccggatatcgtcttcgatgagtggggtttgcaggacaggctactgctgtgcagctacccg
ctcgtacaaatcctccgagaacgcgccattgccgagatcgtcttcaacaccccgatcaag
gattgcgccaatgccctggtccaggaagcgctgatcgaaaacgcccgtgagaatgtcagc
gccatcgtgattggaaaccggcgtgagcaaggctag

DBGET integrated database retrieval system