KEGG   Agrobacterium fabrum: Atu4335
Entry
Atu4335           CDS       T00070                                 
Symbol
impI
Name
(GenBank) putative forkhead-type phosphopeptide-binding protein
  KO
K11894  type VI secretion system protein ImpI
Organism
atu  Agrobacterium fabrum
Brite
KEGG Orthology (KO) [BR:atu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:atu02044]
    Atu4335 (impI)
Secretion system [BR:atu02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Atu4335 (impI)
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-ProteinID: AAK89105
UniProt: A9CGG1
Position
linear:complement(1467064..1468263)
AA seq 399 aa
MKLALKNTRNIGTGKAGQWSFERGRRAIGRSRDCDWQIDDNERRVSKLHCTLSRDGEGFI
ILDQSANGTLVDGRLLLEGESARLRDGSQINIGGQIFEVAISGNAELDFSDPDASLKMSD
ETLTISAILADIAPNGRSAGGLLGNTAAADDWPETRRESAGRKAKSISRNVEIGWSEPPS
AQGIGTVLPDDWDTEPAASSDHEHTDALNTPVMISRPVSASHDRDFDSVFPDTDEDPIRQ
GRLPADTATAQEIGDLLTALERESADCLAILDIESDHAGQGPAPSLSERMETLIGQQRRL
AASLETLMHGCTQKLEPRLLEAAVDAGNDFRAKIGRRDWQGLVMKTDYWSAYKKQFEENG
RPLPVRQFLQRAARGEAASARETDATAADAKGVNNHDET
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgaagcttgcactcaagaacacacggaacatcgggacgggaaaagccggccagtggagc
ttcgagcgaggccgccgcgcaattggccggtctcgtgattgcgactggcagatcgatgac
aatgagcggcgcgtttccaagctgcattgcacgctgagccgcgacggcgaaggtttcatc
atcctcgaccagagcgcaaacggcacgctcgtcgatggccgtctgttgcttgagggcgaa
agcgcgcgtcttcgggacggttcgcagatcaatatcggcgggcagattttcgaggtcgcc
atcagcggcaatgcggagctcgatttttccgatcccgacgcctcgctgaagatgagtgac
gagacgctgaccatttcggcgatccttgccgatatcgccccgaacggccgttctgccggc
ggcctgctgggcaacaccgccgccgccgatgactggccggaaacacggcgcgaaagcgcg
ggccggaaggcgaagtccatttcgcgcaacgtcgagatcggctggagcgaaccgccctct
gcgcagggaattggcactgttctgcctgatgactgggatacggagccggctgcaagcagc
gaccacgaacataccgatgcgctgaacacgccggtcatgatctcacgtccggtctcggct
tcgcatgaccgggattttgacagcgttttcccggatacagacgaagacccgatccgccag
ggcagattgcccgcggacacggcgaccgcacaggagatcggcgatcttctgacggcactg
gaaagggaaagtgccgattgcctggccatcctcgacattgagagcgatcatgccggccaa
ggcccggcaccatccctcagcgagcgaatggaaacgctcattggccagcagcgccgtctt
gccgcctcgctcgaaaccctcatgcatggctgcacgcagaaactcgagccccggcttctt
gaggccgctgtcgatgccggcaacgattttcgcgcgaagatcgggcgcagagactggcag
gggctggtcatgaagaccgactactggtcggcttacaaaaaacaattcgaagaaaacggc
cgtccattgccggtcaggcagttcctgcagcgggcagcgcgtggtgaagccgcgtccgca
cgggagactgacgcgaccgcggccgatgccaagggggtaaacaaccacgatgagacatga

DBGET integrated database retrieval system