KEGG   Agrobacterium fabrum: Atu4345
Entry
Atu4345           CDS       T00070                                 

Definition
(RefSeq) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
atu  Agrobacterium fabrum
Pathway
atu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:atu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Atu4345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:atu02044]
    Atu4345
Secretion system [BR:atu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Atu4345
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-GeneID: 1136219
NCBI-ProteinID: NP_356310
UniProt: A9CGG8
Position
linear:1479996..1480472
AA seq 158 aa
MPIYLQIDGIQGDATHEEHRKWMDIEAIHWNVARNMNTSAGSAANREASEPTISEVILTK
VSDSSSTKLFQEACAGRTGKLATIHLVTTGNPGNTYIEYLLTNTLIASYSVDSSGDRPVE
TIKLNFTKMEVKYTPFDDNNSPQSPMIASYDLATTKAA
NT seq 477 nt   +upstreamnt  +downstreamnt
atgccaatttatctgcagattgacggtatccagggcgacgccacccatgaagaacatcgc
aagtggatggatattgaagccattcactggaacgtggcccgcaacatgaacacgtcggct
ggttctgctgcaaaccgcgaagcgtccgaaccgaccatttcggaagtcattctgacaaag
gttagcgactcgtcttccacaaagcttttccaggaggcctgtgctggccgcactggcaag
cttgcaacgattcatctggtgacgaccggcaatccgggcaacacctatatcgaatacctg
ctgacgaacacccttatcgccagctactcggtggattccagcggggatcgtccggtggag
accatcaagctcaacttcacgaaaatggaagtgaagtacacgccgttcgacgacaacaac
tcgccgcagtctccgatgatcgcttcctacgatctggcgacgaccaaggctgcttga

DBGET integrated database retrieval system