KEGG   Agrobacterium fabrum: Atu4346
Entry
Atu4346           CDS       T00070                                 
Name
(GenBank) conserved hypothetical protein
Organism
atu  Agrobacterium fabrum
SSDB
Motif
Pfam: Rap1a
Other DBs
NCBI-ProteinID: AAK89094
UniProt: A9CGG9
Position
linear:1480579..1480968
AA seq 129 aa
MRSLYAVFVSVPFVLALSGLSPAGAAERTWIFSGAELKQAIEGKLAPDVSDPEMRRLVSV
AKSSAYIAGVADLTSGSDWCGAGAVAPHELTDRIYTYLGDMPAEKLDEQAATLVREALKV
SFPCEQKSN
NT seq 390 nt   +upstreamnt  +downstreamnt
atgcgctccctatatgcggtttttgtctccgtgccatttgttctggccctgtccggtctc
tcaccggccggtgcggcggaacggacatggatattctccggtgccgaactcaagcaggcc
attgaggggaagctcgctcctgatgtgtctgatccggaaatgcggcggctggtttccgtc
gcaaaatcgagcgcctacatcgccggtgtggccgatctgacaagcggatcggactggtgt
ggtgcgggtgccgttgcgccccatgaactcaccgaccggatctacacctatctcggcgat
atgcctgcggaaaaactggatgaacaggcagcaaccctcgtgcgggaggcgctcaaggtc
tcctttccctgtgagcagaaaagtaactag

DBGET integrated database retrieval system