KEGG   Agrobacterium fabrum: Atu4348
Entry
Atu4348           CDS       T00070                                 

Symbol
vgrG
Name
(GenBank) VgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
atu  Agrobacterium fabrum
Pathway
atu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:atu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Atu4348 (vgrG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:atu02044]
    Atu4348 (vgrG)
Secretion system [BR:atu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Atu4348 (vgrG)
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF6484 Gp5_C
Other DBs
NCBI-ProteinID: AAK89092
UniProt: A9CGH0
Position
linear:1481495..1483945
AA seq 816 aa
MNDQPSVSDFVQASRVLKVSSPLGEDQLLPERLSVEEGVSQLFEIRLTVRAKKEAVKPEE
LIGRLVDVSIEISQGDGDGGGVRRPFNGLVTELHEGPPITRGMRSYALTIRPQMWLLSRR
SDCRIWMDKTAVEIVETLFSEHGIPAPDTSGIISPPPAQHYSVQFNETDLDYLTRRFEED
GLFYWFSHEDGSHKLHVADSASGWLGPSPAAQGEGMVRLAQGSSDRNHINDWARRFSYVS
GQRAGADWNFETPGMVPGTMTPSLVQMPDATKRELYEYPARIKTVEEAERAQKLRTQAIE
ADHDRVFGSSTTRILEAGRRFTPFEVAHPEHAYEEHVIVRASHSIVDLSYETNSNEPEYR
NHFEAIPARVPLTPHRSTKRPRIEGTQVAIVAGPEGEEIHPDQYGRIKLWFPWDRKAKKD
GTDTCWVRVSQAWGGGTWGAQVIPRIGMEVMVAFVDGDPDKPLVIGVVNNPANSVPYDLP
ANKTRMVLRSNSHKGDGFNEITFEDEAGKENQFFHAQKDQTTRVLNDRTKRIDRHEVASV
GGNRAVEVSGNQKHEIGGSVNTVVGGTGPMAMMAMAGVQALSGQTAGLLSQAAQIAGGGG
PGVAAFATTLASSALGFLGAGGLSSREGVVSGPSPRADAGTALAGSGSGVGSDASGLFPL
PGIMNTIIGAFQSTSVGVAKAEQVGVSKVTNIGQTEVRQVGKQQNLTIGKEQFVEIGTGQ
YTRVGEKITINVGKLYNLVSEEKYHGEAKVWEIFADDEIRLSTPGGYISLTKSGIKLFAL
KIDIEGNQINFKKGGPGESGSCLKSMSKNSTPFVRI
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgaacgaccagccttcggtttctgatttcgttcaggcgagccgtgttctgaaagtgtct
tcgcccttgggcgaggaccagcttctgccggaacgcctgtccgtcgaggagggcgtgtcg
cagctcttcgagatccgcctgaccgtgcgagccaagaaggaagcggtgaagcccgaggaa
ctgatcggacggctggtcgatgtctcgatcgagataagccagggcgatggtgatggcggc
ggcgttcgccgccccttcaacggcctggtgacggaattgcatgaagggccgccgattacc
cgtggcatgcgctcctatgcgctgaccatccggccgcagatgtggctgctgtcgcgccgc
tccgattgccgcatctggatggacaagacggcggtcgagatcgtcgagacgctgttttcc
gaacatggcattcccgcccccgatacatcgggcatcatttcaccgccgcctgcccagcac
tacagcgttcagtttaacgagacggatctcgattatctcactcgccgtttcgaagaggac
ggcctgttttactggttcagccacgaggacgggtcccacaagctgcatgtggccgatagc
gccagcggctggctcggaccatcaccggccgcacagggcgagggaatggtgcgcctggcg
cagggctcgtcggaccgtaaccacatcaacgactgggcgcgacggttctcctatgtctcg
ggccagcgcgcgggtgcggactggaatttcgagacaccgggcatggtgccgggcacgatg
acgccatcgctggtgcagatgccggatgcgacgaagcgcgagctttacgaatatccagcc
cgcatcaagacagtggaagaagcggaacgggcgcagaaactgcggacccaggcaattgag
gccgatcatgaccgggtgttcggctcatcgaccacgcgtattctggaagcgggccgtcgc
ttcacgcctttcgaggttgcgcatcccgagcatgcctacgaggagcatgtgatcgtgagg
gcaagccacagtattgttgatctctcctatgagacaaacagcaacgaaccggagtaccgc
aatcacttcgaggcaattcccgcccgcgtgccgctgacgccgcaccggtcaaccaaacgg
ccgcgcatcgaaggcacgcaggtggcgatcgtcgccggccccgaaggcgaggaaatccat
ccggatcaatatggccgcatcaagctgtggttcccgtgggaccgcaaggcgaagaaggat
ggcacggatacgtgctgggtgcgggtcagccaggcatggggtggcggcacttggggtgcg
caggtcattccgcgcatcggcatggaggtgatggttgcttttgtcgatggcgatcctgat
aagccgctggttatcggcgtggtcaacaatcccgccaattccgtgccttacgacctgccg
gccaacaagacgcgtatggtgctgcgctccaacagtcacaagggtgacggtttcaacgaa
atcactttcgaagatgaagccggcaaggagaaccagttcttccacgcccagaaggaccag
acgacgcgggtcttgaacgaccggaccaaacgcatcgaccggcacgaggtcgcctcggtc
ggcggcaaccgcgccgtcgaggtttccggcaaccagaaacacgagatcggtggttcggtg
aatactgtcgtcggcggaacgggaccgatggcgatgatggcgatggcaggcgtgcaggcg
ctttcaggacagacggctggcctgctttcacaggccgcccagattgccggcggtggtggt
cctggtgtcgcagcctttgccaccacgcttgcctcatccgcactcggatttcttggtgca
ggcggactttcctcgcgcgagggcgttgtctccggtccaagcccgcgggcggatgcgggt
acggcacttgccggctccggctcgggcgtcggttccgatgcctcgggcctctttccgctg
ccgggcatcatgaacacgatcatcggggcgtttcagtccacatccgttggagtggcaaaa
gccgagcaggtcggggtcagcaaggtcacgaatatcgggcagacggaagtccgacaggtt
ggaaaacagcagaacctgaccatcggcaaagagcaattcgtcgagatcggtaccggccaa
tatacgcgtgtcggtgagaagatcaccatcaatgtcggcaagctctacaatctcgtctcc
gaagagaaatatcatggcgaggcgaaggtctgggagatattcgccgacgacgaaattcgt
ctttcgactcccggcggatacatctccctgactaaaagcggcatcaagctctttgccctg
aagatcgatatcgaaggcaaccagatcaacttcaagaaaggtggcccaggtgaaagtggc
tcctgcttgaagtcgatgtcgaagaattccacaccgtttgtcaggatttga

DBGET integrated database retrieval system