KEGG   Agrobacterium fabrum: Atu4350
Entry
Atu4350           CDS       T00070                                 

Definition
(RefSeq) hypothetical protein
Organism
atu  Agrobacterium fabrum
SSDB
Motif
Pfam: Ntox15 TraT Halogen_Hydrol
Other DBs
NCBI-GeneID: 1136224
NCBI-ProteinID: NP_356305
UniProt: A9CGH1
Position
linear:1484901..1485737
AA seq 278 aa
MSATTTVAGAGGAIAGGWLGRVIGGLAGSLAGPGGTAVGAWIGGQVGAMAGRAAASAIAS
YMEDANVDADAKTKESEQAKPCVDCGEIDCFSPPEGATPKQVEEFRRQLKEQQDEINRME
PDDLVRNIDKYRQQGRPTDDAANRRQSREDYRTDRTRELEEKYLSKGRNDYKEQAANDVA
EEMKKLAATHTLDLVAGGDGSISGLGDKSINSSLGSQWKGRRSEQLRSHAKKAAEQKKKM
NAKLEECKPEGGNDNSPDAETPDNGTGKGDGNPDVPVS
NT seq 837 nt   +upstreamnt  +downstreamnt
atgagtgcgacgacaactgtcgccggagcgggcggtgctatcgcaggaggttggctcggt
cgtgttattggaggcttagctggcagcctcgctgggcctggaggtacagcggttggagca
tggataggtgggcaagtcggcgctatggcgggtagagcggctgcctccgcaatcgcctct
tatatggaagatgcgaatgtagacgctgacgccaagaccaaggagagcgaacaggccaaa
ccttgcgttgattgtggggaaatcgattgctttagtccgcctgagggagctacgcctaag
caagttgaagagtttaggcgtcagttgaaggagcaacaagacgaaataaaccgcatggag
cctgatgatctggtcagaaatatcgacaaatatagacagcaggggaggccgactgatgat
gcagcaaaccgtcggcagagtagagaagattatcgcaccgaccgcacacgggaactggaa
gaaaagtatttatcgaaagggcgcaatgactataaggaacaggctgcgaatgatgtggca
gaagagatgaagaagttggccgcaacccataccttggatttggttgcggggggcgacgga
tcaatttctggcttgggcgacaagagtatcaatagttctttagggtctcaatggaaggga
agaagatcggagcaattgcgctctcatgcaaaaaaagcggctgagcaaaagaaaaaaatg
aacgctaaactcgaagaatgtaaacccgaaggcggcaatgataattctcccgatgctgaa
actcccgacaatggtacaggtaagggggacggcaatcctgacgtcccggtgtcttga

DBGET integrated database retrieval system