KEGG   Agrobacterium fabrum: Atu4665Help
Entry
Atu4665           CDS       T00070                                 

Gene name
melA
Definition
(RefSeq) alpha-galactosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
atu  Agrobacterium fabrum
Pathway
atu00052  Galactose metabolism
atu00561  Glycerolipid metabolism
atu00600  Sphingolipid metabolism
atu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Atu4665 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    Atu4665 (melA)
   00600 Sphingolipid metabolism
    Atu4665 (melA)
Enzymes [BR:atu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Atu4665 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C Ldh_1_N
Motif
Other DBs
NCBI-GeneID: 1136539
NCBI-ProteinID: NP_355997
UniProt: Q7CVJ3
Position
linear:1823423..1824796
Genome map
AA seq 457 aa AA seqDB search
MARDPKITFIGAGSTVFMKNIIGDVLQRPALSGATIALMDINRERLEESAIVVNKLISTL
GAKAKAETYTDQKKALAGADFVVVAFQIGGYEPCTVTDFEVPRKYGLRQTIADTLGVGGI
MRGLRTVPHLWKICEDILAVCPNAVMLQYVNPMAINTWAIAEKYPTIRQVGLCHSVQGTA
MELAHDLDIPYEEIRYRSAGINHMAFFLEFEHRQPDGSYRNLYPDLVRGYREGRAPKPGW
NPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKEGRDDLIEKFGIPLDEYPKRCIEQ
IERWKGQAAAYRSAEKIEVKQSKEYASSIINSVWTGEPSVIYGNQRNNGCITSLPSDCAA
EVPCLVDHNGVQPTFIGELPPQLTALMRTNINVQELTVRALMSENRAHIFHAAMMDPHTA
AELDLDQIWSLVDDLLLAHRDWLPEWTQAEVKRARAV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcaagagatcccaagatcacatttatcggcgcaggctctacggtgttcatgaagaac
atcatcggcgacgtgctgcagcgtccggccctttcgggcgccaccattgcgctgatggac
atcaatcgcgagaggctggaagaaagcgccatcgtcgtcaacaagctgatttcgacattg
ggggcaaaggcgaaagccgagacctataccgaccagaaaaaggcgcttgccggtgccgat
tttgtcgtggtcgccttccagatcggcggatatgaaccctgtacggttaccgatttcgag
gtgccgcgcaaatatggcctgcgccagaccattgccgatacgctcggcgtcggcggcatc
atgcgtggtcttcgcaccgtgccgcatctgtggaaaatctgcgaggatatcctcgccgtc
tgccccaacgccgtcatgctgcaatatgtgaacccgatggcgatcaacacctgggcgatt
gccgagaaatacccgacgatccggcaggttggcctttgccattccgtgcagggcacggcc
atggaactcgcccatgatctcgatatcccttatgaggagatccgctatcgttcggccggc
atcaaccacatggcgtttttcctcgaattcgagcatcgccagcccgacggcagctatagg
aacctctatcccgatctcgtgcgcggctaccgcgaaggccgtgcgccaaaacccggctgg
aacccgcgttgccccaacaaggtgcgttacgagatgctgacgcgactcggttatttcgtc
accgaaagctcggaacatttcgccgaatatacgccctatttcatcaaggaggggcgcgac
gacctgatcgagaaattcggcatcccgctcgatgaatatccgaagcgctgcatcgaacag
atcgagcgctggaaggggcaggcggcggcctatcgttcggccgagaagatcgaggttaag
caatcgaaggaatatgcctcctccatcatcaactccgtctggactggcgaaccctccgtc
atctatggcaaccagcgcaacaacggctgcatcacctcgctcccatcggattgcgcggca
gaagtgccctgccttgtcgaccataacggcgtgcagcccacctttatcggcgaattgccg
ccgcaactcaccgccctgatgcgcaccaacatcaacgtgcaggaactgacggtgcgggcg
ctgatgagcgaaaaccgtgcccatatcttccacgcggcgatgatggacccgcacacggcg
gcggaactggatctcgaccagatatggtcgctggtagacgacctactgctcgcacaccgc
gactggttgccggaatggacgcaggcggaggtgaagcgggcgcgggcggtgtaa

DBGET integrated database retrieval system