KEGG   Agrobacterium fabrum: Atu4740Help
Entry
Atu4740           CDS       T00070                                 

Definition
(RefSeq) zinc-binding dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
atu  Agrobacterium fabrum
Pathway
atu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:atu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Atu4740
Enzymes [BR:atu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Atu4740
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Atu4740
    1.1.1.-  
     Atu4740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 1136614
NCBI-ProteinID: NP_355925
UniProt: Q7CVQ9
Position
linear:complement(1908230..1909303)
Genome map
AA seq 357 aa AA seqDB search
MRALRFHAAKDLRIEDIAEPKRPGPGQVLVRNRFVGICGTDLHEYSYGPIFIPTEPHPFT
GAHGPQILGHEFGGVVEAIGDGVTSVNVGDRVSIQPLIMPRSGDYFADRGLFHLSTQLAL
VGLSWDGGGMAEAALVNEYNVQKIPDEMTDEEAALVEPSAVAVYACDRGGVTAGNSVLVT
GAGPIGMLTLLAARAAGATQLFVSDLNDARLELARNVIRDVITINPKRDNVGDVVRSATE
GKVGCDVAIECVGNEHALKACVDAVRKQGVVVQTGLHPHENPIDWFQVTFRDLEIKGSWA
YPTHYWPRVIRLIASGLLPATKIVTKRITLDTAVTEGFDALLDPAGTHLKILIDLSK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgctcagatttcatgcagccaaggatttgcggatcgaagacattgccgagccg
aaacggcctggcccgggacaggtcctcgtccgcaaccgtttcgtcggcatctgcggcacc
gatctgcatgaatatagctacggcccgatcttcattcccaccgaaccgcatccttttacc
ggcgcccatggcccacagattctgggccacgaattcggcggcgtggttgaggcgatcggc
gacggtgtgacctccgtcaacgtcggcgaccgcgtctccatccagccgctcatcatgccg
cgatccggcgattatttcgctgatcgtggccttttccatctcagcacgcaactggcactg
gtcggcctcagctgggacggcggcggcatggcggaagccgcacttgtcaacgaatacaac
gtccagaaaattccggacgagatgaccgacgaagaggccgcactggtggaaccctcggcc
gttgccgtttatgcctgtgatcgcggtggcgttaccgccggtaatagcgttctggtcacg
ggtgccggcccgatcggcatgttgacgcttctggcggcccgcgccgccggcgctacccag
ctttttgtctccgatctgaatgacgcccgcctcgagcttgcccgcaatgtcatccgtgat
gtcatcaccatcaaccccaagcgcgataatgtcggtgatgtcgtccgctcggcaaccgaa
ggcaaggtcggctgcgacgtggcgatcgaatgcgtgggtaatgaacatgcgctcaaggcc
tgcgttgacgccgtgcgcaagcagggcgtcgtcgtgcaaaccgggctgcacccgcatgaa
aacccgatcgactggttccaggtgacgttccgtgatctggagatcaagggctcctgggcc
tatccgacccattactggccgcgcgtcatccggctcattgcctccggcctgctgccggcg
acgaagatcgtcaccaagcgcatcacgctggatacggccgtgaccgagggcttcgatgcc
ctgctcgaccccgccggcacgcatctgaaaatcctgatcgatctttcgaaatag

DBGET integrated database retrieval system