KEGG   Agrobacterium fabrum: Atu6038
Entry
Atu6038           CDS       T00070                                 
Symbol
trbE
Name
(GenBank) conjugal transfer protein
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
atu  Agrobacterium fabrum
Pathway
atu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:atu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Atu6038 (trbE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:atu02044]
    Atu6038 (trbE)
Enzymes [BR:atu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Atu6038 (trbE)
Secretion system [BR:atu02044]
 Type IV secretion system
  Trb secretion system protein
   Atu6038 (trbE)
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_22 AAA_10 ABC_tran AAA_29 DUF87 AAA_21 ATPase_2 AAA_23 AAA_16 FtsK_SpoIIIE DUF4485 AAA_30 CbiA T2SSE Zeta_toxin
Other DBs
NCBI-ProteinID: AAK90996
UniProt: Q7D2P4
Position
Ti:complement(47104..49572)
AA seq 822 aa
MVALKQFRHSGPSFADLVPYAGLVDNGVILLKDGSLMAGWYFAGPDSESSTDAERNEVSR
QINMILSRLGSGWMIQVEALRVPTIDYPAEDACHFPDPVTRAIDAERRSHFERESGHFES
RHALILTWRPPEPRRSGLTRYVYADAGSRSATYADTALDSFRTSIREVEQYLANVVSIRR
MMTQETQERGGFRRARYDELFQFIRFCITGENHPIRLPDIPMYLDWLVTAELQHGLTPTI
ENRFLGVVAIDGLPAESWPGILNSLDLMPLTYRWSSRFVFLDEQEARSRLERTRKKWQQK
VRPFFDQLFQTQSRSVDQDAMMMVAETEDAIAQAASQLVAYGYYTPAIILFDEVQPRLQE
KCEAIRRLIQAEGFGARIETLNATDAFLGSLPGVSYANIREPLVNTRNLADLIPLNSVWS
GNPVAPCPFYPAGSPPLMQVASGSTPFRLSLHVDDVGHTLVFGPTGSGKSTLLALIAAQF
RRYAGAQIFAFDKGRSMLPLTLAIGGDHYEIDGDAAGEGEGASPRLAFCPLAELSTDGDR
AWAAEWIETLVALQGVTVTPDYRNAISRQLVLMAESRGRSLSDFVSGVQMREIKDALHHY
TVDGPMGQLLDAEEDGLALGAFQCFEVEELMNMGERNLVPVLLYMFRRVEKRLTGAPSLI
IIDEAWLMLGHPTFRDKIREWLKVLRKANCAVVLATQSISDAERSGIIDVLKESCPTKIC
LPNGAAREPGTREFYERIGFNERQIEIVATAMPKREYYVASPEGRRLFDMSLGPVALSFV
GASGKEDLKSIRALHSENGADWPIHWLQQRGIAHAETLFPAA
NT seq 2469 nt   +upstreamnt  +downstreamnt
atggtggcactgaaacagttccgacactccggcccgtccttcgccgacctggttccctat
gctggactggtcgacaacggcgtgatcctgctgaaggacggctcgctgatggctggctgg
tattttgccgggccggacagcgaaagttcgaccgacgccgagcgcaatgaggtcagccgg
cagatcaatatgatcctctcccggctgggctcgggctggatgatacaggtcgaagcgttg
cgcgtcccgacgatcgactatccggcagaggacgcctgccatttccccgatccggtgacg
cgtgcgattgacgccgagcgcagatctcattttgagagggagagcggacatttcgagagc
cgacacgccctgatcctgacctggcggccccccgagccaaggcgatcggggctgacgcgc
tacgtctatgccgatgcagggagccgttctgccacctacgcggatacggcgctcgattcc
ttccgcacttcgatccgcgaagtggagcaatatcttgccaatgtcgtctccatacgccgc
atgatgacccaggagacgcaagagcgtggcggtttccgccgcgcgcgctacgacgagctg
ttccagttcattcgcttctgcatcactggcgagaaccaccccatccgcctgccggatatc
ccgatgtatctcgattggctggtcaccgctgagctccagcacggcctgacgccgaccatc
gagaaccgtttcctcggtgtcgtcgccatcgacggcctgccggcggagagttggccggga
atcctgaacagcctcgacctgatgccgctcacctatcgatggtcgtcgcgctttgtcttt
ctcgatgagcaggaggcacgctcgaggctggagcgcacccgcaagaagtggcagcagaag
gtcaggccgtttttcgaccagcttttccagacgcagagccgctcggtcgatcaggacgcc
atgatgatggtggccgagaccgaggatgcaatcgctcaagccgcctcgcagctcgtcgcc
tacggctactacacgccggccatcatcctgttcgacgaagtccagccacgccttcaggaa
aagtgcgaggcgatccgccgcctgatccaggccgagggctttggcgcccggatcgaaact
ctcaacgcaaccgacgcttttctcggcagcctgccgggcgtttcctatgccaacatccgc
gagccgctggtcaatacccgcaatctcgccgacctcatcccgctgaactcggtctggtcc
ggaaacccggtcgcaccgtgcccgttctatccggccggctcaccgccactcatgcaggtc
gccagcggatcgacgccattccgccttagcctccacgtcgacgatgttggccacacgctc
gtcttcggtccgacgggttctggaaagtccaccctgctggcgctgatcgccgcgcagttt
cgccgctatgccggcgcgcagatcttcgcctttgacaagggccgctccatgctgccgctg
acgctcgccatcggcggcgatcactacgagatcgacggcgacgcggccggagaaggggag
ggagcatcgccacgactggccttctgcccgctcgccgaactctcgaccgatggcgaccgc
gcctgggcagccgagtggatcgagacacttgtcgcgctgcagggcgtcactgtcacgcct
gactatcgcaacgccatttccagacagttggtcttgatggcggaatcgcgcggccgctcg
ctctcggacttcgtctccggggtgcagatgcgcgagataaaagacgcgctgcaccactac
accgtcgatgggccgatgggtcagttgctcgatgccgaagaggacggactggcgctcggc
gccttccagtgcttcgaggtcgaggagctgatgaacatgggcgagcgcaacctcgtaccg
gtcttgctctatatgttccggcgtgtcgagaagcgtctgaccggcgctccaagcctgatc
atcatcgacgaagcctggctgatgctcggtcatccgaccttccgcgacaagatccgcgaa
tggttgaaggtcctgcgaaaagccaattgcgcggtcgtactcgccacgcaatcgatctcg
gacgcggagcgctccggcatcatcgacgtgctcaaggagtcctgcccgaccaagatatgc
ctgcccaacggcgcggcacgcgaaccagggacacgcgagttttatgagcggatcggcttc
aacgagcggcagatcgagatcgtcgcaaccgccatgccgaagcgcgaatattacgtcgcc
tcgccggagggtcgcaggctcttcgatatgtcgctcggtcccgtggcgctctccttcgtc
ggtgcgtccggcaaggaggatctgaagagcatccgcgcccttcattctgaaaacggggcg
gattggcccattcactggctccagcaaagggggatcgcccatgccgagacacttttcccg
gccgcttga

DBGET integrated database retrieval system