KEGG   Agrobacterium fabrum: Atu6039
Entry
Atu6039           CDS       T00070                                 
Symbol
trbD
Name
(GenBank) conjugal transfer protein
  KO
K20529  type IV secretion system protein TrbD
Organism
atu  Agrobacterium fabrum
Pathway
atu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:atu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Atu6039 (trbD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:atu02044]
    Atu6039 (trbD)
Secretion system [BR:atu02044]
 Type IV secretion system
  Trb secretion system protein
   Atu6039 (trbD)
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: AAK90997
UniProt: Q7D2P3
Position
Ti:complement(49583..49882)
AA seq 99 aa
MAEPGSNLARSRVHRALSRPNLLMGADRELVLLTGLAAVILIFVVLTWYAALFGVAIWLV
AVAALRMMAKSDPLMRRVYLRHVSYRSHYRPTSTPWRKF
NT seq 300 nt   +upstreamnt  +downstreamnt
atggctgagccgggttccaaccttgcgcgttctcgggtccaccgggcgctgtcgcgcccg
aacctgctgatgggcgccgaccgcgagctggtattgctcaccgggcttgccgccgtgatc
ctgatcttcgtcgtgctgacgtggtacgccgcattgttcggcgtcgcgatctggctcgtt
gcggtcgcggcccttcgcatgatggcgaaatccgacccgctgatgcgccgcgtttatctg
cggcatgtctcctatcggtcccactatcggccgacctcgacgccctggcgcaagttttga

DBGET integrated database retrieval system